SecReT4
Protein ID: 32469979
T4SS name [ID]Tra_F [104]
Gene symboltraY
Locus tagp165897_006
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]3822..4217 [+]
Productconjugal transfer protein TraY
Component typeTraY_F
UniProt IDQ7B3W9, P06627
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 4.4e-38, Aligned region: 15..58
TraY [PF05509], Evalue: 4.4e-38, Aligned region: 70..117
Protein Sequence: 131 a.a.     [Download]
>gi|32469979|ref|NP_862918.1| conjugal transfer protein TraY [Escherichia coli]
MKRFGTRSATGKMVKLKLPVDVESLLIEASNRSGRSRSFEAVIRLKDHLHRYPKFNRAGNIYGKSLVKYL
TMRLDDETNQLLIAAKNRSGWCKTDEAADRVIDHLIKFPDFYNSEIFREADKEEDITFNTL
 
Nucleotide Sequence: 396 bp     [Download]
>gi|32469973|ref|NC_004998.1|:3822-4217 Escherichia coli plasmid p1658/97, complete sequence
TTGAAAAGATTTGGTACACGTTCTGCAACAGGTAAGATGGTAAAACTAAAATTACCTGTAGATGTGGAAA
GTCTATTAATTGAGGCAAGTAACAGAAGCGGAAGAAGTCGATCGTTTGAGGCAGTAATAAGACTTAAAGA
TCATCTTCACCGCTATCCAAAGTTTAACAGGGCAGGGAATATCTATGGTAAGTCGCTGGTTAAGTATCTG
ACAATGCGTCTGGATGATGAAACTAACCAGCTACTTATTGCAGCCAAAAATCGTAGTGGATGGTGTAAAA
CAGATGAGGCTGCAGACAGAGTTATTGATCATTTGATCAAGTTTCCTGATTTTTATAACTCGGAGATATT
CAGGGAGGCAGATAAAGAGGAAGATATAACATTTAATACACTCTAG
 Primer design