SecReT4
Protein ID: 32469980
T4SS name [ID]Tra_F [104]
Gene symboltraA
Locus tagp165897_007
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]4250..4615 [+]
Productconjugal transfer pilin subunit TraA
Component typeTraA_F
UniProt IDB7LI65, P04737, Q7B3W8
KEGG IDecz:pECS88_0066
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 1.9e-59, Aligned region: 1..120
Protein Sequence: 121 a.a.     [Download]
>gi|32469980|ref|NP_862919.1| conjugal transfer pilin subunit TraA [Escherichia coli]
MNAVLSVQGASAPVKKKSFFSKFTRLNMLRLARAVIPAAVLMMFFPQLAMAAGSSGQDLMASGNTTVKAT
FGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVGL
 
Nucleotide Sequence: 366 bp     [Download]
>gi|32469973|ref|NC_004998.1|:4250-4615 Escherichia coli plasmid p1658/97, complete sequence
ATGAATGCTGTTTTAAGTGTTCAGGGTGCTTCTGCGCCCGTCAAAAAGAAGTCGTTTTTTTCCAAATTCA
CTCGTCTGAATATGCTTCGCCTGGCTCGCGCAGTGATCCCGGCTGCTGTTCTGATGATGTTCTTCCCGCA
GCTGGCGATGGCCGCCGGCAGCAGTGGTCAGGACCTGATGGCAAGCGGTAACACCACGGTTAAGGCGACC
TTCGGTAAGGACTCCAGTGTTGTTAAATGGGTTGTTCTGGCTGAAGTTCTGGTCGGTGCTGTCATGTACA
TGATGACCAAAAACGTCAAGTTCCTGGCCGGTTTTGCCATCATCTCTGTATTTATTGCTGTGGGTATGGC
CGTCGTTGGCCTCTGA
 Primer design