SecReT4
Protein ID: 32469983
T4SS name [ID]Tra_F [104]
Gene symboltraK
Locus tagp165897_010
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]5516..6244 [+]
Productconjugal transfer protein TraK
Component typeTraK_F
UniProt IDB7LJ55, Q7B3W5, P41066, B7LI68
KEGG IDecz:pECS88_0069, eum:p1ECUMN_0108
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 4.3e-70, Aligned region: 12..235
Protein Sequence: 242 a.a.     [Download]
>gi|32469983|ref|NP_862922.1| conjugal transfer protein TraK [Escherichia coli]
MRKNNTAIIFGSLFFSCSVMAANGTLAPTVVPMVNGGQASIAISNTSPNLFTVPGDRIIAVNSLDGALTN
NEQTASGGVVVATVNKKPFTFILETERGLNLSIQAVPREGAGRTIQLVSDLRGTGEEAGAWETSTPYESL
LVTISQAVRGGKLPAGWYQVPVTKETLQAPAGLSSVADAVWTGNHLKMVRFAVENKTLSALNIRESDFWQ
PGTRAVMFSQPASQLLAGARMDVYVIRDGEGN
 
Nucleotide Sequence: 729 bp     [Download]
>gi|32469973|ref|NC_004998.1|:5516-6244 Escherichia coli plasmid p1658/97, complete sequence
ATGAGAAAAAATAATACGGCAATAATATTCGGCAGCCTGTTTTTTTCCTGCAGCGTGATGGCCGCAAACG
GTACGCTGGCCCCCACCGTGGTGCCAATGGTGAACGGTGGTCAGGCCAGTATTGCCATCAGCAATACCAG
CCCGAATCTGTTTACCGTTCCCGGTGACCGGATTATCGCCGTGAACAGTCTGGATGGTGCCCTGACCAAT
AATGAGCAGACCGCCTCCGGCGGTGTGGTGGTTGCCACCGTCAACAAAAAGCCCTTTACGTTCATTCTGG
AAACAGAACGTGGTCTGAATCTTTCCATTCAGGCCGTTCCCCGTGAAGGCGCGGGGCGTACCATTCAGCT
GGTCAGTGACCTGCGCGGAACCGGAGAAGAAGCCGGTGCGTGGGAAACGTCCACGCCTTACGAATCCCTG
CTTGTGACCATCAGCCAGGCCGTCCGTGGCGGAAAATTACCCGCAGGCTGGTATCAGGTCCCAGTGACAA
AGGAAACCCTGCAGGCCCCGGCGGGGCTGTCTTCAGTGGCAGATGCCGTATGGACGGGGAATCACCTGAA
GATGGTCCGCTTTGCCGTGGAAAATAAAACGCTGTCTGCCCTGAATATCCGGGAAAGTGACTTCTGGCAG
CCGGGAACCCGTGCCGTGATGTTCAGCCAGCCTGCCAGCCAGTTACTGGCAGGTGCGCGCATGGATGTGT
ATGTCATCCGTGACGGGGAGGGCAACTGA
 Primer design