SecReT4
Protein ID: 32469984
T4SS name [ID]Tra_F [104]
Gene symboltraB
Locus tagp165897_011
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]6244..7671 [+]
Productconjugal transfer pilus assembly protein TraB
Component typeTraB_F
UniProt IDQ84A33
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.6e-40, Aligned region: 213..409
CALCOCO1 [PF07888], Evalue: 2.2e-05, Aligned region: 68..121
Protein Sequence: 475 a.a.     [Download]
>gi|32469984|ref|NP_862923.1| conjugal transfer pilus assembly protein TraB [Escherichia coli]
MASINTIVKRKQYLWLGIVVVGTASAIGGALYLSDVDMSGNGETVAEQEPVPDMTGVLDTTFDDKVRQHA
TTEMQVTAAQMQKQYEEIRRELNVLNKQRGDDQRRIEKLGQDNAALAEQVKALGANPVTATGEPVPQMPA
SPPGPEGEPQPGNTPVSFPPQGSVAVPPPTAFYPGNGVTPPPQVTYQSVPVPNRIQRKVFTRNEGKQGPS
LPYIPSGSFAKAMLIEGADANASVTGNESTVPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSSERAI
VRTRNISCLKDGKTIDMPIKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQPAVGLG
ATAAYGAGDVLKMGIGGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTVEEMALERT
QSRAEEDNPESPVPVPPSAESHLNGFNTDQMLKQLGNLNPQQFMSGSQGGGNDGK
 
Nucleotide Sequence: 1428 bp     [Download]
>gi|32469973|ref|NC_004998.1|:6244-7671 Escherichia coli plasmid p1658/97, complete sequence
ATGGCCAGTATCAATACCATTGTGAAACGCAAGCAGTACCTGTGGCTGGGGATTGTGGTTGTCGGTACAG
CCTCCGCGATTGGTGGGGCACTGTATCTGTCTGATGTGGACATGTCCGGTAACGGTGAAACCGTGGCTGA
ACAGGAGCCTGTGCCGGATATGACCGGTGTGCTGGATACGACCTTTGATGACAAGGTGCGTCAGCATGCC
ACCACCGAGATGCAGGTGACGGCAGCGCAGATGCAGAAGCAGTATGAGGAAATCCGTCGTGAGCTGAATG
TTCTGAACAAACAGCGCGGTGATGACCAGCGTCGTATTGAAAAGTTGGGACAGGACAATGCCGCCCTGGC
AGAGCAGGTAAAAGCCCTGGGTGCTAATCCCGTCACGGCGACCGGTGAGCCTGTACCGCAGATGCCTGCC
TCACCGCCCGGCCCGGAAGGCGAACCACAGCCAGGAAACACCCCCGTATCCTTCCCGCCGCAGGGCAGCG
TTGCTGTTCCACCGCCGACGGCGTTTTATCCCGGGAATGGTGTCACGCCACCACCACAGGTGACGTACCA
GTCTGTGCCGGTGCCTAACCGGATACAGCGTAAGGTGTTTACCCGTAATGAGGGAAAACAGGGACCATCA
CTGCCGTACATTCCGTCAGGAAGTTTTGCGAAAGCCATGCTGATTGAAGGGGCGGATGCCAATGCCTCTG
TCACCGGTAATGAATCCACGGTGCCGATGCAGCTGCGTATCACCGGCCTGGTGGAAATGCCGAACAGCAA
GACGTATGACGCAACGGGATGTTTTGTGGGTCTGGAAGCCTGGGGGGATGTGTCCAGTGAGCGTGCCATT
GTACGCACCCGCAATATCAGTTGCCTGAAGGACGGCAAAACTATTGATATGCCGATTAAGGGGCATGTCA
GCTTCCGGGGTAAAAACGGTATCAAGGGCGAAGTGGTGATGCGTAACGGCAAAATCCTCGGCTGGGCATG
GGGCGCGGGATTTGTTGACGGTATCGGTCAGGGAATGGAGCGCGCCTCCCAGCCGGCTGTCGGGCTGGGT
GCCACAGCCGCTTACGGGGCTGGTGATGTCCTGAAAATGGGTATCGGTGGCGGCGCATCGAAAGCCGCAC
AGACGCTCAGTGACTACTACATCAAACGTGCCGAACAGTATCACCCGGTGATACCGATTGGTGCGGGCAA
CGAAGTGACCGTGGTGTTCCAGGACGGCTTCCAGCTGAAAACCGTGGAAGAGATGGCGCTGGAACGCACG
CAGAGCAGAGCGGAAGAAGACAATCCGGAAAGTCCGGTTCCTGTTCCGCCATCGGCTGAAAGTCATCTTA
ACGGCTTTAATACTGACCAGATGCTGAAGCAGCTGGGCAACCTGAATCCGCAGCAGTTTATGTCCGGCAG
CCAGGGAGGGGGCAACGATGGCAAATAA
 Primer design