SecReT4
Protein ID: 32469988
T4SS name [ID]Tra_F [104]
Gene symboltraV
Locus tagp165897_015
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]8695..9210 [+]
Productconjugal transfer protein TraV
Component typeTraV_F
UniProt IDQ84A31, B7LI73
KEGG IDecz:pECS88_0074
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 7.1e-40, Aligned region: 23..165
Protein Sequence: 171 a.a.     [Download]
>gi|32469988|ref|NP_862927.1| conjugal transfer protein TraV [Escherichia coli]
MKQISFFIPLLGTLLLSGCAGTSTEFECNATTSDTCMTMEQANEKAKKLERSSEAKPVAASLPRLAEGNF
RTMPVQTVTATTPSGSRPAVTAHPEQKLLAPRPLFTAAREVKTVVPVSSVTPVTPPRPLRTGEQTAALWI
APYIDNQDVYHQPSSVFFVIKPSAWGKPRIN
 
Nucleotide Sequence: 516 bp     [Download]
>gi|32469973|ref|NC_004998.1|:8695-9210 Escherichia coli plasmid p1658/97, complete sequence
ATGAAACAGATTTCTTTCTTTATTCCTCTGCTGGGGACCTTATTACTTTCCGGCTGTGCCGGAACCAGTA
CGGAATTTGAGTGTAACGCCACCACATCCGATACCTGTATGACGATGGAGCAGGCCAATGAGAAGGCCAA
AAAACTGGAGCGGTCCTCAGAAGCAAAGCCGGTTGCGGCATCACTGCCGCGCCTGGCTGAAGGGAACTTC
CGGACAATGCCGGTGCAGACCGTCACCGCGACCACTCCGTCCGGCAGCAGACCTGCGGTGACAGCACATC
CGGAGCAGAAACTGCTGGCACCTCGCCCGCTGTTTACCGCTGCCCGGGAAGTGAAAACGGTTGTTCCGGT
CAGTTCAGTTACGCCGGTAACACCTCCTCGTCCGCTAAGAACGGGTGAGCAGACGGCAGCATTATGGATA
GCGCCTTATATTGATAACCAGGATGTTTATCATCAGCCATCCAGCGTGTTTTTTGTTATTAAACCGTCTG
CGTGGGGAAAACCACGTATTAATTAA
 Primer design