SecReT4
Protein ID: 32469990
T4SS name [ID]Tra_F [104]
Gene symboltraC
Locus tagp165897_017
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]9726..12353 [+]
Productconjugal transfer ATP-binding protein TraC
Component typeTraC_F
UniProt IDQ84A30
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 4.5e-59, Aligned region: 37..277
AAA_10 [PF12846], Evalue: 2.6e-43, Aligned region: 479..772
DUF87 [PF01935], Evalue: 2.6e-05, Aligned region: 482..669
TrwB_AAD_bind [PF10412], Evalue: 5.5e-05, Aligned region: 479..517
Protein Sequence: 875 a.a.     [Download]
>gi|32469990|ref|NP_862929.1| conjugal transfer ATP-binding protein TraC [Escherichia coli]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNVADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYVESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA
 
Nucleotide Sequence: 2628 bp     [Download]
>gi|32469973|ref|NC_004998.1|:9726-12353 Escherichia coli plasmid p1658/97, complete sequence
GTGAATAACCCACTTGAGGCCGTCACTCAGGCGGTTAACTCCCTCGTCACAGCACTGAAACTGCCTGACG
AATCCGCAAAGGCCAATGAAGTTCTGGGCGAAATGAGCTTCCCGCAGTTCAGCCGTCTGCTGCCGTACCG
TGATTACAACCAGGAATCCGGTCTGTTCATGAATGACACCACGATGGGCTTTATGCTGGAAGCCATCCCC
ATCAATGGGGCGAATGAGTCCATTGTGGAGGCCCTCGATCACATGCTGCGCACCAAACTGCCGCGCGGTA
TTCCGTTGTGTATCCATCTGATGTCCAGTCAGCTGGTTGGTGACAGGATTGAATACGGGCTGCGTGAGTT
CTCCTGGTCAGGTGAACAGGCTGAACGGTTTAACGCCATTACCCGGGCCTATTATATGAAAGCGGCAGCG
ACACAGTTTCCGCTGCCGGAGGGGATGAATCTGCCCCTGACCCTGCGCCATTACCGGGTGTTTATCTCGT
ACTGTTCTCCTTCGAAGAAAAAAAGCCGGGCCGACATTCTGGAAATGGAAAACCTGGTGAAAATCATCCG
GGCGTCGTTACAGGGGGCCAGTATCACCACACAGACGGTGGATGCACAGGCCTTTATCGATATTGTCGGG
GAGATGATTAACCATAACCCGGACTCCCTGTACCCGAAAAGACGTCAGCTGGACCCGTATTCTGATCTGA
ATTATCAGTGTGTGGAGGACAGTTTTGATCTGAAAGTCCGGGCTGATTACCTGACGCTGGGCCTGCGTGA
GAACGGCAGGAACAGCACGGCCCGCATCCTGAATTTCCATCTGGCCCGTAACCCGGAAATCGCCTTCCTG
TGGAACGTGGCCGACAACTACAGCAACCTGCTGAACCCGGAACTGTCCATCTCCTGTCCGTTCATCCTGA
CGCTGACTCTGGTGGTGGAAGACCAGGTGAAAACCCACAGCGAAGCCAACCTGAAGTACATGGACCTGGA
GAAAAAGTCGAAGACCTCCTATGCCAAATGGTTTCCGTCCGTGGAGAAAGAGGCGAAGGAGTGGGGGGAA
TTGCGTCAGCGGCTGGGCTCCGGTCAGTCCTCCGTGGTGTCCTACTTCCTCAACATCACAGCATTCTGCA
AGGACAATAATGAAACGGCGCTGGAAGTGGAGCAGGACATCCTGAACAGCTTTCGTAAAAACGGTTTTGA
GCTGATTTCACCGCGCTTTAACCACATGCGCAATTTCCTGACCTGCCTGCCCTTTATGGCCGGGAAAGGG
CTGTTTAAACAGCTGAAAGAGGCCGGAGTGGTTCAGCGCGCAGAGAGCTTTAATGTTGCCAACCTGATGC
CGTTAGTGGCGGATAACCCCCTGACACCGGCAGGTCTGCTGGCACCCACCTACCGTAACCAGCTGGCGTT
TATCGATATTTTCTTCCGGGGGATGAATAACACCAACTACAACATGGCGGTCTGTGGCACCTCCGGGGCC
GGTAAAACCGGGCTGATACAGCCACTTATCCGCAGCGTGCTGGACTCCGGAGGCTTTGCCGTGGTGTTCG
ACATGGGGGATGGATACAAGTCCCTGTGTGAGAACATGGGCGGGGTGTATCTGGACGGTGAAACCCTGCG
TTTTAACCCGTTTGCGAACATCACCGATATTGACCAGTCAGCGGAGCGTGTCCGTGACCAGTTGTCAGTG
ATGGCCAGCCCCAACGGTAACCTGGATGAAGTGCATGAAGGTCTGCTGTTGCAGGCGGTCAGAGCCTCCT
GGCTGGCCAAAGAGAACAGAGCACGTATTGATGACGTGGTGGATTTCCTGAAAAACGCCAGTGACAGCGA
GCAGTATGTCGAGTCACCGACTATCCGCAGCCGTCTGGACGAAATGATTGTGCTGCTTGACCAGTACACT
GCCAACGGCACTTACGGCCAGTATTTTAACTCTGATGAGCCGTCCCTGCGGGATGACGCAAAAATGGTGG
TGCTGGAGCTGGGCGGACTGGAAGACCGTCCGTCACTGCTGGTTGCGGTGATGTTCTCCCTGATTATCTA
CATCGAGAACAGGATGTACCGCACGCCGCGTAACCTCAAGAAACTGAACGTTATTGATGAAGGCTGGCGT
CTGCTGGACTTCAAAAATCACAAGGTCGGTGAATTTATTGAGAAAGGCTACCGTACGGCCCGCCGTCATA
CCGGTGCCTATATCACCATCACACAGAACATCGTCGACTTTGACTCTGATAAGGCCTCCAGTGCTGCCCG
CGCGGCATGGGGTAACTCCTCCTACAAAATTATCCTCAAACAGAGTGCGAAGGAGTTCGCGAAATACAAC
CAACTGTATCCGGACCAGTTCCTGCCACTGCAGCGCGACATGATTGGTAAGTTTGGTGCGGCCAAAGACC
AGTGGTTCAGTTCCTTCCTGCTGCAGGTGGAAAACCATTCCTCCTGGCACCGTCTGTTTGTGGACCCGTT
AAGCCGCGCCATGTACAGCTCTGACGGCCCGGATTTTGAGTTTGTGCAGCAGAAGCGTAAAGAGGGGCTG
AGTATTCATGAGGCAGTGTGGCAGCTGGCGTGGAAGAAGTCAGGGCCGGAAATGGCTTCGCTGGAAGCCT
GGCTGGAAGAACATGAGAAATACAGGAGTGTGGCATGA
 Primer design