SecReT4
Protein ID: 32469992
T4SS name [ID]Tra_F [104]
Gene symboltraU
Locus tagp165897_020
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]13362..14354 [+]
Productconjugal transfer pilus assembly protein TraU
Component typeTraU_F
UniProt IDQ84A29
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 2.3e-84, Aligned region: 29..329
Protein Sequence: 330 a.a.     [Download]
>gi|32469992|ref|NP_862932.1| conjugal transfer pilus assembly protein TraU [Escherichia coli]
MKRRLWLLMLFLFAGHVPAASADSACEGRFVNPITDICWSCIFPLSLGSIKVSQGKVSDTANPSMPIQIC
PAPPPLFRRIGLAIGYWEPMALTDVTRSPGCMVNLGFSLPAFGKTAQGTAKKDEKQVNGAFYHVHWYKYP
LTYWLNIITSLGCLEGGDMDIAYLSEIDPTWTDSSLTTILNPEAVIFANPIAQGACAADAIASAFNMPLD
VLFWCAGSQGSMYPFNGWVSNESSPLQSSLLVSERMAFKLHRQGMIMETIGKNNAVCNEYPSPILPKERW
RYQMVNMYPDSGQCHPFGRSVTRWETGKNPPNTKKNFGYLMWRKRNCVFL
 
Nucleotide Sequence: 993 bp     [Download]
>gi|32469973|ref|NC_004998.1|:13362-14354 Escherichia coli plasmid p1658/97, complete sequence
ATGAAGCGAAGGCTGTGGCTGCTGATGTTATTCCTTTTCGCCGGTCATGTCCCTGCGGCGTCTGCGGATT
CTGCCTGTGAGGGGCGTTTTGTAAACCCGATCACAGATATCTGCTGGAGCTGTATTTTCCCGCTCTCGCT
GGGCAGTATCAAAGTCAGTCAGGGTAAGGTCTCCGACACGGCGAACCCGTCGATGCCCATTCAGATTTGT
CCGGCACCGCCGCCGCTGTTCAGGCGTATCGGGCTGGCCATTGGTTACTGGGAGCCGATGGCGTTGACGG
ACGTCACCCGGTCACCGGGATGCATGGTGAACCTGGGCTTCAGCCTGCCGGCTTTTGGTAAAACGGCACA
GGGAACGGCGAAAAAGGATGAGAAGCAGGTAAATGGGGCGTTCTATCACGTTCACTGGTACAAATACCCG
CTGACGTACTGGCTGAACATCATCACATCGCTGGGCTGTCTGGAAGGTGGTGACATGGATATCGCTTATC
TTTCTGAAATCGACCCCACCTGGACGGACAGCAGCCTGACCACCATTCTCAATCCGGAAGCTGTCATCTT
TGCCAATCCGATAGCACAGGGAGCCTGCGCAGCAGATGCGATTGCCAGCGCCTTTAATATGCCTCTCGAT
GTTCTGTTCTGGTGTGCCGGTTCGCAGGGAAGTATGTACCCGTTCAATGGCTGGGTGAGTAATGAGTCCA
GTCCGTTGCAGTCCTCCCTGCTGGTCAGTGAACGCATGGCGTTCAAGCTGCACCGTCAGGGCATGATTAT
GGAAACCATCGGGAAAAATAACGCCGTCTGTAATGAATATCCGTCCCCAATCCTGCCCAAAGAACGCTGG
CGTTACCAGATGGTGAATATGTATCCGGACAGCGGGCAGTGCCACCCGTTCGGGCGCAGCGTGACCCGCT
GGGAAACCGGGAAAAATCCGCCCAACACAAAGAAAAACTTCGGCTACCTGATGTGGCGTAAACGTAACTG
TGTCTTCCTGTGA
 Primer design