SecReT4
Protein ID: 32469993
T4SS name [ID]Tra_F [104]
Gene symboltrbC
Locus tagp165897_021
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]14363..15001 [+]
Productconjugal transfer pilus assembly protein TrbC
Component typeTrbC_F
UniProt IDQ84A28
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1.4e-27, Aligned region: 93..191
Protein Sequence: 212 a.a.     [Download]
>gi|32469993|ref|NP_862933.1| conjugal transfer pilus assembly protein TrbC [Escherichia coli]
MKLSMKSLAALLMMLNGAVMASENVNTPENRQFLKQQENLSRQLREKPDHQLKAWAEKQVLENPLQRSDN
HFLDELVRKQQASQDGKPLQGALYFVSFSIPEEGLKRMLGETRHFGIPATLRGMVNNDLKTTAEAVLSLV
KDGATDGVQIDPTLFSQYGIRTVPALVVFCSQGYDIIRGNLRVGQALEKVAATGDCRQVAHDLLAGKGDS
GK
 
Nucleotide Sequence: 639 bp     [Download]
>gi|32469973|ref|NC_004998.1|:14363-15001 Escherichia coli plasmid p1658/97, complete sequence
ATGAAGCTGAGTATGAAATCTCTGGCAGCACTGCTGATGATGCTGAACGGGGCGGTTATGGCGTCAGAAA
ACGTGAACACTCCTGAAAACCGCCAGTTCCTGAAGCAGCAGGAAAATTTAAGCAGACAACTGCGTGAAAA
ACCTGACCATCAGCTGAAAGCCTGGGCGGAGAAACAGGTGCTGGAAAACCCCCTTCAGCGTTCAGATAAC
CATTTCCTGGATGAGCTGGTTCGTAAACAGCAGGCTTCGCAGGACGGGAAACCCCTGCAGGGTGCTCTGT
ATTTTGTGTCGTTTTCCATTCCCGAAGAGGGGCTGAAACGAATGCTGGGCGAAACCCGGCACTTCGGTAT
TCCGGCCACACTGCGGGGCATGGTGAACAATGACCTGAAGACCACCGCTGAAGCTGTGTTGTCCCTGGTG
AAAGACGGCGCGACTGATGGTGTTCAGATCGACCCGACGCTGTTTTCACAGTACGGCATTCGCACTGTAC
CGGCACTGGTGGTGTTCTGCAGTCAGGGATACGACATCATCCGGGGAAACCTGCGGGTCGGCCAGGCGCT
GGAGAAAGTGGCCGCCACGGGTGACTGCCGGCAGGTGGCTCATGATTTACTGGCAGGGAAAGGAGATTCC
GGGAAATGA
 Primer design