SecReT4
Protein ID: 32469994
T4SS name [ID]Tra_F [104]
Gene symboltraN
Locus tagp165897_022
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]14998..16806 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDQ84A27
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 3.2e-74, Aligned region: 306..552
Protein Sequence: 602 a.a.     [Download]
>gi|32469994|ref|NP_862934.1| conjugal transfer mating pair stabilization protein TraN [Escherichia coli]
MKRILPLILALVAGMAQADSNSDYRAGSDFAHQIKGQGSSSIQGFKPQESIPGYNANPDETKYYGGVTAG
GDGGLKNDGTTEWATGETGKTITESFMNKPKDILSPDAPFIQTGRDVVNRADSIVGNTGQQCSAQEISRS
EYTNYTCERDLQVEQYCTRTARMELQGSTTWETRTLEYEMSQLPAREVNGQYVVSMTSPVTGEIVDAHYS
WSRTYLQKSVPMTITVLGTPLSWNAKYSADASFTPVQKTLTAGVAFTSSHPVRVGNTKFKRHTAMKLRLV
VRVKKASYTPYVVWSESCPFSKELGKLTKTECTEAGGNRTLVKDGQSYSMYQSCWAYRDTYVTQSADKGT
CQTYTDNPACTLVSHQCAFYSEEGACLHEYATYSCESKTSGKVMVCGGDVFCLDGECDKAQSGQSNDFAE
AVSQLAALAAAGKDVAALNGVDVRAFTGQAKFCKKAAAGYSNCCKDSGWGQDIGLAKCSSDEKALAKAKS
NKLTVSVGEFCSKKVLGVCLEKKRSYCQFDSKLAQIVQQQGRNGQLRISFGSAKHPDCRGITVDELQKIQ
FNRLDFTNFYEDLMNNQKIPDSGVLTQKVKEQIADQLKQAGQ
 
Nucleotide Sequence: 1809 bp     [Download]
>gi|32469973|ref|NC_004998.1|:14998-16806 Escherichia coli plasmid p1658/97, complete sequence
ATGAAACGTATTTTACCTCTGATACTGGCTCTGGTTGCCGGCATGGCACAGGCTGACAGCAACAGTGATT
ACCGGGCCGGTTCTGATTTTGCTCACCAGATCAAAGGGCAGGGAAGCAGCAGTATTCAGGGCTTTAAGCC
ACAGGAGAGTATCCCCGGCTATAACGCGAATCCGGACGAGACAAAATATTACGGTGGCGTGACTGCCGGC
GGGGATGGCGGCCTGAAAAATGACGGCACCACGGAATGGGCGACCGGTGAAACCGGAAAAACCATTACAG
AGTCATTCATGAACAAGCCGAAAGACATTCTTTCACCGGATGCACCGTTTATCCAGACCGGCAGGGATGT
GGTGAACCGGGCTGACAGCATTGTGGGAAACACCGGGCAGCAGTGCAGTGCGCAGGAGATTAGCAGGAGT
GAATACACGAATTACACCTGTGAGCGGGATTTACAGGTGGAGCAGTACTGCACACGAACTGCCCGTATGG
AGCTGCAGGGGAGTACCACATGGGAAACCCGGACGCTGGAGTATGAAATGAGTCAGCTACCTGCACGTGA
AGTGAATGGTCAGTATGTTGTCTCCATGACCTCTCCCGTTACCGGTGAAATTGTCGATGCGCATTACAGC
TGGAGTCGTACTTACTTGCAGAAGAGTGTACCTATGACAATTACAGTACTGGGAACCCCACTGAGCTGGA
ATGCCAAATACTCAGCAGATGCCTCATTTACACCAGTACAGAAAACACTGACTGCCGGTGTGGCTTTTAC
GTCATCTCACCCCGTCCGGGTCGGGAATACAAAATTCAAACGTCATACGGCAATGAAGCTGCGTCTGGTT
GTCAGGGTAAAAAAAGCCTCGTACACCCCGTATGTTGTCTGGTCTGAAAGCTGCCCGTTCAGCAAGGAGC
TGGGGAAACTGACAAAAACAGAATGTACGGAGGCTGGCGGGAACAGGACGCTGGTGAAAGACGGTCAGTC
ATACAGCATGTACCAGAGCTGCTGGGCATACCGGGACACGTATGTCACGCAGTCAGCAGACAAGGGAACC
TGTCAGACCTACACCGACAATCCTGCCTGTACCCTGGTGTCACACCAGTGTGCCTTTTACTCCGAAGAAG
GTGCCTGTCTGCATGAATATGCCACGTACTCCTGTGAGTCAAAAACATCCGGGAAAGTGATGGTCTGTGG
GGGAGACGTCTTCTGTCTCGATGGCGAATGCGATAAGGCTCAGAGCGGGCAGAGTAATGATTTTGCCGAA
GCCGTTTCTCAGCTGGCGGCACTGGCCGCAGCAGGTAAGGATGTTGCGGCGCTGAACGGGGTGGATGTCC
GTGCTTTCACCGGTCAGGCGAAATTTTGTAAGAAGGCTGCAGCCGGATACAGCAACTGCTGTAAGGACAG
CGGCTGGGGACAGGATATCGGGCTGGCCAAATGCAGCAGTGATGAAAAGGCCCTGGCTAAAGCAAAATCA
AACAAACTGACCGTCAGCGTCGGGGAGTTCTGTTCGAAGAAAGTGCTGGGTGTCTGTCTGGAGAAAAAAC
GCAGCTACTGTCAGTTTGATTCGAAGCTGGCGCAGATAGTCCAGCAGCAGGGGCGCAACGGTCAGTTGCG
TATCAGTTTTGGTAGTGCGAAGCATCCTGACTGTCGGGGGATTACGGTTGATGAGCTGCAGAAAATTCAG
TTCAACAGACTGGATTTCACTAACTTCTACGAAGACCTGATGAATAACCAGAAAATCCCGGACAGTGGCG
TTCTGACGCAGAAAGTGAAAGAGCAGATTGCTGACCAGCTGAAACAGGCAGGACAGTAA
 Primer design