SecReT4
Protein ID: 32469996
T4SS name [ID]Tra_F [104]
Gene symboltraF
Locus tagp165897_024
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]17053..17826 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDQ84A26
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.7e-78, Aligned region: 33..247
Protein Sequence: 257 a.a.     [Download]
>gi|32469996|ref|NP_862936.1| conjugal pilus assembly protein TraF [Escherichia coli]
MKEKVMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQT
ATKRALYEAILYPGVDNFVKYFRLQNYWAQQAGLFTMSARKAMLAHPELDYNLQYSHYNGTVRNQLAADQ
AQQRQAIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQR
LGVKYFPAMMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 774 bp     [Download]
>gi|32469973|ref|NC_004998.1|:17053-17826 Escherichia coli plasmid p1658/97, complete sequence
ATGAAAGAAAAAGTGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTA
TTTTTCCGGCGTCAGGAAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGA
AAATAAACCTGTACCTGCAGCCCCCCGTCAGGAACCGGATATTATGCAGAAACTGGCCGCACTGCAGACG
GCAACAAAGCGGGCGCTGTACGAAGCCATTCTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGC
TGCAAAATTACTGGGCTCAGCAGGCCGGGCTTTTCACCATGAGCGCCAGAAAGGCCATGCTGGCACATCC
TGAACTGGACTATAACCTGCAGTACAGTCATTACAACGGCACGGTACGGAACCAGCTGGCAGCAGACCAG
GCGCAGCAGCGACAGGCCATTGCGAAACTGGCTGAACACTACGGCATCATGTTTTTTTACCGGGGGCAGG
ACCCCATCGACGGGCAACTGGCGCAGGTCATTAATGGCTTCCGGGATACGTATGGTCTGAGTGTTATTCC
CGTTTCCGTGGATGGCGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGC
CTCGGCGTGAAATATTTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTATCAT
ACGGCTTTATTTCGCAGGACGACCTGGCAAAACAGTTCCTGAACGTTTCTGAAGATTTTAAACCCAATTT
TTAA
 Primer design