SecReT4
Protein ID: 32469999
T4SS name [ID]Tra_F [104]
Gene symboltraQ
Locus tagp165897_027
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]18586..18870 [+]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDP18033, Q7B3V8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 1.2e-50, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|32469999|ref|NP_862939.1| conjugal transfer pilin chaperone TraQ [Escherichia coli]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSRE
EREALEARQQAMMEGQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|32469973|ref|NC_004998.1|:18586-18870 Escherichia coli plasmid p1658/97, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGCTGAT
TGCGGCCATTCTCGTACTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design