SecReT4
Protein ID: 32470003
T4SS name [ID]Tra_F [104]
Gene symboltraH
Locus tagp165897_031
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]20038..21414 [+]
Productconjugal transfer pilus assembly protein TraH
Component typeTraH_F
UniProt IDP15069, Q7B3V5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 5.1e-116, Aligned region: 30..379
Protein Sequence: 458 a.a.     [Download]
>gi|32470003|ref|NP_862943.1| conjugal transfer pilus assembly protein TraH [Escherichia coli]
MMPRIKPLLVLCAALLTVTPAASADVNSDMNQFFNKLGFASNTTQPGVWQGQAAGYAYGGSLYARTQVKN
VQLISMTLPDINAGCGGIDAYLGSFSFINGEQLQRFVKQIMSNAAGYFFDLALQTTVPEIKTAKDFLQKM
ASDINSMNLSSCQAAQGIIGGLFPRTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGKSDSVRDKASDK
DKERVTKNINIMWNALSKNRMFDGNKELKEFVMTLTGSLVFGPNGEITPLSARTTDRSIIRAMMEGGTAK
ISHCNDSDKCLKVVADTPVTISRDNALKSQITKLLASIQNKAVSDTPLDDKEKGFISSTTIPVFKYLVDP
QMLGVSNSMIYQLTDYIGYDILLQYIQELIQQARAMVATGNYDEAVIGHINDNMNDATRQIAAFQSQVQV
QQDALLVVDRQMSYMRQQLSARMLSRYQNNYHFGGSTL
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|32469973|ref|NC_004998.1|:20038-21414 Escherichia coli plasmid p1658/97, complete sequence
ATGATGCCACGCATTAAACCTCTTCTGGTTCTTTGTGCCGCCTTACTGACGGTGACGCCTGCAGCGTCAG
CGGATGTGAACAGCGACATGAATCAGTTCTTTAATAAGCTGGGATTTGCTTCCAATACCACACAGCCGGG
CGTCTGGCAGGGGCAGGCCGCCGGCTATGCTTACGGTGGCTCCCTGTATGCCCGTACTCAGGTCAAAAAT
GTTCAGCTAATTTCCATGACGCTGCCGGATATCAATGCTGGATGTGGCGGCATCGACGCCTATCTCGGCT
CGTTCAGTTTTATTAATGGTGAGCAGTTGCAGCGTTTTGTTAAGCAGATTATGAGCAATGCTGCCGGTTA
CTTTTTTGACCTTGCCCTGCAGACAACGGTGCCGGAAATAAAAACCGCAAAAGACTTCCTGCAGAAAATG
GCAAGCGACATTAACAGTATGAACCTCAGTTCCTGCCAGGCTGCACAGGGGATTATCGGCGGGCTTTTCC
CCCGGACGCAGGTGTCCCAGCAAAAAGTCTGTCAGGACATTGCCGGTGAGAGCAATATTTTTGCTGACTG
GGCGGCTTCCCGGCAGGGATGTACCGTTGGCGGGAAATCTGACAGCGTCAGGGATAAAGCCAGCGACAAG
GATAAGGAGCGGGTGACCAAAAACATCAACATCATGTGGAATGCGCTTTCCAAAAACAGAATGTTTGACG
GCAACAAAGAGCTGAAAGAGTTTGTGATGACGCTGACCGGCTCACTGGTGTTTGGTCCCAACGGCGAAAT
CACACCGCTGTCAGCCAGAACCACTGACCGTTCAATTATCCGGGCCATGATGGAAGGCGGCACAGCAAAA
ATTTCTCACTGCAACGATTCTGATAAATGCCTGAAAGTGGTGGCAGACACACCGGTGACCATCAGCCGGG
ATAATGCACTGAAGTCTCAGATTACTAAACTTCTGGCCAGCATTCAGAACAAGGCTGTCAGTGACACGCC
TCTGGATGACAAGGAAAAAGGCTTTATTTCCAGTACCACCATCCCCGTCTTCAAATACCTGGTTGACCCG
CAGATGCTCGGTGTTTCCAACAGTATGATTTACCAGCTGACGGACTATATCGGTTACGACATCCTGCTGC
AGTACATTCAGGAGCTGATACAGCAGGCACGGGCGATGGTGGCCACGGGAAATTATGACGAAGCGGTTAT
CGGGCATATTAACGACAACATGAATGATGCCACCCGGCAGATTGCGGCGTTTCAGTCACAGGTGCAGGTA
CAGCAGGATGCGCTGCTGGTTGTCGATCGTCAGATGAGCTACATGCGTCAGCAGCTTTCCGCCCGCATGC
TCAGTCGTTACCAGAACAACTATCACTTCGGAGGGAGCACGCTGTGA
 Primer design