SecReT4
Protein ID: 32470004
T4SS name [ID]Tra_F [104]
Gene symboltraG
Locus tagp165897_032
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]21411..24227 [+]
Productconjugal transfer mating pair stabilization protein TraG
Component typeTraG_F
UniProt IDQ84A23
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 4.2e-126, Aligned region: 3..450
Protein Sequence: 938 a.a.     [Download]
>gi|32470004|ref|NP_862944.1| conjugal transfer mating pair stabilization protein TraG [Escherichia coli]
MNEVYVIAGGEWLRNNLNAIAAFMGTWTWDSIEKIALTLSVLAVAVMWVQRHNVMDLLGWVAVFVLISLL
VNVRTSVQIIDNSDLVKVHRVDNVPVGLAMPLSLTTRIGHAMVASYEMIFTQPDSVTYSKTGMLFGANLI
VKSTDFLSRNPEIINLFQDYVQNCVLGDIYLNHKYTLEDLMASADPYTLIFSRPSPLRGVYDNNNNFITC
KDASVTLKDRLNLDTKTGGKTWHYYVQQIFGGRPDPDLLFRQLVSDSYSYFYGSSQSASQIMRQNVTMNA
LKEGITSNAARNGDTASLVSLATTSSMEKQRLAHVSIGHVTMRNLPMVQTILTGIAIGIFPLLILAAVFN
KLTLSVLKGYVFALMWLQTWPLLYAILNSAMTFYAKQNGAPVVLSELSQIQLKYSDLASTAGYLSAMIPP
LSWMMVKGLGAGFSSVYSHFASSSISPTASAAGSVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMMYQT
GSGATATQTRDGNMVMDASGAMSRLPVGINATRQIAAAQQEMAREASNRAESALHGFSSSIASAWNTLSQ
FGSNRGSSDSVTGGADSTMSAQDSMMASRMRSAVESYAKAHNISNEQATRELASRSTNASLGLYGDAYAK
GHLGISVLGNGGGVGLQAGAKASIDGSDLDSHEASSGSRASHDARHDIDARATQDFKEASDYFTSRKVSE
SGSHTDNNADSRVDQLSAALNSAKQSYDQYTTNMTRSHEYAEMASRTESMSGQMSEELSQQFAQYVMKNA
PQDVEAILTNTSSPEIAERRRAMAWSFVQEQVQPGVDNTWRESRRDIGKGMESVPSGGGSQDIIADHQGH
QAIIEQRTQDSNIRNDVKHQVDNMVTEYRGNIGDTQNSIRGEENIVKGQYSELQNHHKTEALTQNNKYNE
EKLAQERIPGADSPKELLEKAKSYQHKE
 
Nucleotide Sequence: 2817 bp     [Download]
>gi|32469973|ref|NC_004998.1|:21411-24227 Escherichia coli plasmid p1658/97, complete sequence
GTGAATGAAGTTTATGTGATTGCCGGTGGTGAGTGGTTGCGGAATAACCTGAACGCCATTGCCGCCTTTA
TGGGAACCTGGACGTGGGATTCCATTGAAAAAATTGCGCTCACATTGTCTGTTCTCGCGGTGGCCGTAAT
GTGGGTACAGCGGCACAACGTGATGGATTTGCTGGGCTGGGTGGCCGTGTTTGTGCTTATCAGCCTGCTG
GTTAATGTCCGCACATCGGTGCAGATTATTGATAACAGTGACCTGGTCAAAGTTCACCGGGTGGATAATG
TGCCGGTCGGTCTGGCGATGCCACTTTCACTGACGACCCGTATCGGGCATGCAATGGTGGCCAGTTACGA
GATGATCTTCACGCAACCGGACAGCGTCACCTACAGCAAAACGGGGATGCTGTTCGGGGCGAATCTGATT
GTGAAAAGCACCGATTTCCTGTCCCGGAATCCGGAAATCATCAATCTGTTCCAGGACTACGTCCAGAACT
GCGTGCTGGGTGATATTTACCTGAATCATAAATACACGCTGGAAGACCTGATGGCCTCCGCTGACCCCTA
CACGCTGATTTTTTCCCGCCCCAGCCCGCTACGGGGCGTTTATGACAACAATAATAATTTCATAACTTGT
AAGGATGCGTCGGTCACGCTGAAAGACAGGCTGAATCTCGATACAAAGACGGGAGGCAAGACCTGGCATT
ATTATGTGCAGCAGATATTTGGCGGCAGACCGGACCCGGACCTGTTATTCAGACAACTGGTCAGTGACAG
TTACAGTTATTTCTACGGCTCCAGTCAGTCTGCCAGCCAGATTATGCGCCAGAACGTCACCATGAATGCC
CTGAAAGAGGGTATCACCAGTAATGCAGCCCGTAACGGTGACACCGCCAGCCTGGTAAGTCTGGCCACCA
CGTCATCGATGGAGAAACAACGTCTGGCACATGTCTCCATTGGTCATGTAACTATGCGAAACCTGCCGAT
GGTCCAGACTATCCTGACGGGGATTGCCATTGGTATATTCCCGCTCCTGATACTGGCGGCTGTCTTTAAC
AAGCTGACATTGTCTGTATTAAAGGGGTATGTGTTTGCCCTGATGTGGCTGCAGACCTGGCCGTTGTTGT
ATGCCATTCTGAACAGTGCCATGACATTCTATGCGAAACAGAATGGTGCGCCGGTCGTGTTGTCTGAACT
CTCTCAGATACAGCTGAAATACTCTGACCTGGCCTCCACTGCCGGGTATCTTTCAGCCATGATCCCCCCG
TTGTCATGGATGATGGTAAAAGGCCTTGGCGCAGGTTTTTCCAGCGTGTACAGCCACTTCGCCTCTTCAT
CTATCAGTCCAACGGCCAGTGCAGCAGGCAGTGTGGTTGACGGTAATTACTCCTACGGCAACATGCAGAC
GGAAAACGTGAACGGCTTCAGCTGGAGCACCAACAGCACCACGTCGTTTGGTCAGATGATGTACCAGACC
GGCAGTGGCGCAACCGCCACACAGACCCGTGACGGTAATATGGTGATGGATGCAAGCGGAGCGATGTCCC
GGTTACCGGTCGGTATCAATGCAACGCGTCAGATTGCAGCGGCACAACAGGAAATGGCCCGGGAGGCGTC
GAACAGAGCCGAAAGTGCCCTGCATGGTTTCAGCAGCAGTATTGCCAGTGCCTGGAACACACTCAGTCAG
TTTGGCTCTAACCGGGGGAGCAGTGACTCTGTCACTGGTGGTGCTGACAGCACGATGAGTGCTCAGGACT
CCATGATGGCCAGCCGTATGCGCAGTGCAGTGGAAAGCTATGCGAAGGCGCATAATATCAGTAATGAGCA
GGCGACGAGAGAACTGGCCTCGAGAAGTACAAATGCGTCGCTTGGCCTTTACGGTGATGCTTATGCTAAA
GGGCATTTAGGCATAAGTGTATTGGGTAACGGTGGAGGGGTTGGTCTCCAGGCCGGAGCTAAGGCAAGCA
TTGATGGCAGTGATCTTGACTCACATGAAGCCAGTAGTGGTTCACGGGCCAGCCATGATGCTCGTCATGA
TATCGATGCCAGAGCTACACAAGACTTTAAAGAAGCCAGCGATTACTTTACCAGCCGCAAAGTCAGTGAA
TCCGGCAGCCATACTGACAATAATGCTGATTCCCGTGTGGATCAGTTGTCTGCAGCCCTGAATTCAGCGA
AACAGAGTTACGACCAGTACACGACGAATATGACCCGCAGCCATGAATATGCTGAAATGGCATCCCGTAC
TGAGAGTATGAGTGGGCAGATGAGTGAAGAGCTGTCGCAACAGTTTGCACAGTATGTGATGAAAAACGCA
CCGCAGGATGTTGAAGCTATTCTGACAAATACCAGTTCGCCGGAGATTGCAGAACGCCGTCGGGCTATGG
CGTGGTCTTTTGTGCAGGAACAGGTACAGCCTGGTGTTGATAACACCTGGCGTGAATCCCGTAGAGATAT
AGGTAAAGGAATGGAGAGCGTACCTTCGGGTGGTGGCAGCCAGGATATTATTGCTGATCATCAGGGACAT
CAGGCCATTATTGAGCAAAGAACGCAGGACAGTAATATCCGTAATGATGTAAAACATCAGGTTGATAATA
TGGTCACAGAATATCGAGGTAATATCGGAGATACTCAGAACAGCATCCGAGGCGAGGAAAATATTGTAAA
AGGGCAGTATTCTGAACTACAAAATCATCATAAAACAGAAGCATTAACTCAGAATAATAAATATAATGAA
GAAAAGCTGGCTCAGGAAAGAATACCTGGTGCTGATAGTCCGAAAGAGCTTTTAGAGAAAGCAAAGAGTT
ACCAGCATAAAGAATAA
 Primer design