SecReT4
Protein ID: 32470007
T4SS name [ID]Tra_F [104]
Gene symboltraD
Locus tagp165897_035
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]25790..27943 [+]
Productconjugal transfer protein TraD
Component typeTraD_F
UniProt IDP09130
KEGG IDNA
PDB ID3D8A
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 7.3e-148, Aligned region: 172..561
TraD_N [PF12615], Evalue: 2e-33, Aligned region: 31..129
TraG-D_C [PF12696], Evalue: 2.1e-18, Aligned region: 419..541
AAA_10 [PF12846], Evalue: 3e-10, Aligned region: 187..491
T4SS-DNA_transf [PF02534], Evalue: 8e-08, Aligned region: 382..478
Protein Sequence: 717 a.a.     [Download]
>gi|32470007|ref|NP_862947.1| conjugal transfer protein TraD [Escherichia coli]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWIKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCSEQLWSAFVLAAVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTYLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAASLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQTRPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPVSPAI
NDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQENHPDIQQQMQRREEVN
INVHRERGEDVEPGDDF
 
Nucleotide Sequence: 2154 bp     [Download]
>gi|32469973|ref|NC_004998.1|:25790-27943 Escherichia coli plasmid p1658/97, complete sequence
ATGAGTTTTAACGCAAAGGATATGACCCAGGGCGGTCAGATTGCGTCCATGCGTATCCGCATGTTCAGCC
AGATCGCCAATATCATGCTTTACTGCCTGTTTATTTTTTTCTGGATACTCGTTGGTCTGGTTTTATGGAT
AAAAATAAGCTGGCAGACGTTTGTGAACGGCTGTATTTACTGGTGGTGTACCACGCTGGAAGGCATGCGG
GATTTAATCAAATCCCAGCCGGTCTATGAGATCCAGTATTACGGTAAAACCTTCCGCATGAACGCTGCTC
AGGTACTGCATGACAAATATATGATCTGGTGCAGTGAGCAGTTATGGTCCGCCTTCGTGCTGGCTGCTGT
TGTGGCACTGGTTATTTGCCTGATTACCTTCTTTGTTGTCTCCTGGATTCTGGGGCGTCAGGGTAAACAA
CAGAGCGAAAATGAAGTCACAGGTGGTCGTCAGCTGACAGACAATCCGAAAGACGTTGCCCGGATGCTGA
AAAAAGACGGCAAGGACTCCGATATCCGGATTGGAGACCTGCCGATTATCCGGGATTCCGAAATCCAGAA
CTTCTGTCTGCACGGCACGGTCGGGGCCGGTAAGTCGGAAGTTATCCGTCGTCTGGCCAACTACGCCCGT
CAACGCGGTGATATGGTGGTGATTTATGACCGTTCGGGGGAATTTGTTAAAAGTTACTATGATCCCTCCA
TCGATAAAATCCTGAATCCGCTGGATGCCCGCTGTGCCGCCTGGGATTTGTGGAAGGAGTGCCTGACACA
GCCGGATTTTGATAATACCGCAAATACTCTGATCCCGATGGGTACAAAAGAGGACCCGTTCTGGCAGGGT
TCAGGACGTACCATTTTTGCGGAAGCGGCGTATCTGATGCGTAATGACCCCAACCGCAGCTACAGCAAAC
TGGTGGACACACTGCTTTCCATCAAAATTGAAAAACTGCGTACCTACCTGCGTAATTCACCGGCGGCCAA
CCTGGTGGAAGAGAAAATTGAGAAAACGGCGATTTCCATCCGTGCTGTGCTGACCAACTACGTGAAAGCC
ATCCGTTACCTGCAGGGGATTGAGCATAACGGTGAGCCTTTTACCATCCGTGACTGGATGCGTGGTGTCC
GGGAAGATCAGAAAAACGGCTGGCTGTTTATTTCGTCGAATGCCGACACCCATGCCTCCCTGAAGCCGGT
GATCTCCATGTGGCTGTCCATTGCCATTCGTGGTCTGCTGGCAATGGGAGAAAACCGTAACCGTCGTGTG
TGGTTTTTCTGTGATGAGTTACCCACGTTACACAAACTGCCGGACCTGGTGGAGATCCTGCCGGAAGCCC
GTAAGTTCGGTGGCTGTTATGTGTTTGGTATCCAGTCCTATGCCCAGCTGGAAGATATCTACGGTGAGAA
AGCGGCTGCCTCGCTGTTTGACGTCATGAACACCCGTGCCTTTTTCCGTTCTCCCAGCCATAAGATTGCA
GAGTTCGCTGCCGGTGAAATTGGTGAGAAAGAGCACCTGAAAGCCAGCGAGCAGTATTCCTACGGTGCTG
ATCCGGTACGTGACGGGGTATCGACCGGTAAGGATATGGAGCGCCAGACGCTGGTCAGTTATTCCGACAT
TCAGTCTCTGCCGGATCTGACCTGTTATGTCACCCTGCCCGGACCGTATCCGGCAGTAAAACTCTCTCTG
AAATATCAGACACGACCGAAGGTCGCTCCGGAGTTTATTCCGCGTGACATCAATCCGGAAATGGAGAACC
GTCTGAGTGCCGTACTTGCCGCAAGGGAAGCAGAAGGTCGTCAGATGGCCAGCCTCTTCGAACCGGATGT
CCCGGAGGTTGTTTCCGGAGAAGACGTGACTCAGGCTGAACAGCCGCAACAGCCGGTGTCTCCTGCCATC
AACGATAAGAAGTCAGATTCAGGTGTGAATGTTCCGGCAGGGGGGATCGAGCAGGAGCTGAAAATGAAAC
CGGAAGAAGAGATGGAACAGCAACTGCCACCCGGGATCAGTGAATCCGGTGAAGTGGTGGATATGGCCGC
TTATGAGGCATGGCAACAGGAAAATCATCCGGACATCCAGCAGCAGATGCAGCGTCGTGAAGAGGTGAAC
ATTAATGTGCACCGGGAGCGCGGGGAGGATGTTGAGCCGGGAGATGATTTCTGA
 Primer design