SecReT4
Protein ID: 32470011
T4SS name [ID]Tra_F [104]
Gene symboltraI
Locus tagp165897_039
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]28659..33929 [+]
Productconjugal transfer nickase/helicase TraI
Component typeTraI_F
UniProt IDQ84A21
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 3.1e-87, Aligned region: 7..287
TraI [PF07057], Evalue: 4.8e-59, Aligned region: 1434..1560
AAA_30 [PF13604], Evalue: 2.8e-42, Aligned region: 968..1156
UvrD_C_2 [PF13538], Evalue: 6.3e-06, Aligned region: 1341..1444
AAA_19 [PF13245], Evalue: 1e-05, Aligned region: 982..1047
Protein Sequence: 1756 a.a.     [Download]
>gi|32470011|ref|NP_862951.1| conjugal transfer nickase/helicase TraI [Escherichia coli]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNRHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQTIREAVGEDASLKSRDVAALDTRKSKQHVDPEIKMVEWMQT
LKETGFDIRAYRDAADQRADLRTLTPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNMKQDERLSGELITGR
RQLLEGMTFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLIIDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYARLAGDFAVSVKAGEESVAQVSGVREQAMLTQTIRSELKTQGVLGHPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVSSVSEDAMTVVVPGRAEPATLPVSDSPFTALKL
ENGWVETPGHSVSDSATVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KTRAGETSLETAISHQKSALHTPAQQAIHLALPVVESKKLAFSMVDLLTEAKSFAAEGTGFTELGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVMPLMERVPGELMEKLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDVPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDVREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWETHRDALVLVDNVYHRIAGISKDDGLITLQDAEGNTRLISPREAVAEGVT
LYTPDTIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTREIRPGQEQAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKLMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVF
EPKPDREVMNAERLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAG
IWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTEQAVREIAGQERDRAAITEREAALPEGVLREPQRVREAVREIARENLLQERLQQMERDMVRDLQKE
KTLGGD
 
Nucleotide Sequence: 5271 bp     [Download]
>gi|32469973|ref|NC_004998.1|:28659-33929 Escherichia coli plasmid p1658/97, complete sequence
ATGATGAGTATTGCGCAGGTCAGATCGGCCGGAAGTGCCGGGAACTATTATACCGACAAGGATAATTACT
ATGTGCTGGGCAGCATGGGAGAACGCTGGGCCGGCAGGGGGGCTGAACAGCTGGGGCTGCAGGGCAGTGT
CGATAAGGATGTTTTTACCCGTCTTCTGGAGGGCAGGCTGCCGGACGGAGCGGATCTAAGCCGCATGCAG
GATGGCAGTAACAGGCATCGTCCCGGCTACGATCTGACCTTCTCCGCCCCCAAAAGTGTCTCCATGATGG
CCATGTTAGGTGGCGATAAGCGCCTGATTGATGCACATAATCAGGCCGTGGATTTTGCTGTCCGTCAGGT
GGAGGCGCTGGCCTCCACACGGGTGATGACGGACGGACAGTCAGAAACGGTGCTGACCGGTAATCTGGTG
ATGGCACTGTTTAACCACGACACCAGTCGCGATCAGGAACCACAGTTACACACGCATGCGGTGGTGGCTA
ATGTCACGCAGCATAATGGCGAATGGAAGACACTGAGCAGTGACAAAGTGGGGAAAACGGGGTTCATTGA
GAATGTGTACGCTAATCAGATTGCCTTTGGCAGGCTCTACCGGGAAAAACTGAAAGAGCAGGTTGAGGCG
CTGGGCTATGAAACTGAAGTGGTTGGTAAGCACGGTATGTGGGAAATGCCGGGTGTACCGGTGGAGGCCT
TTTCCGGACGCTCACAGACTATCCGGGAGGCCGTCGGGGAAGACGCCTCGCTGAAATCCCGGGATGTGGC
GGCGCTGGATACGCGTAAATCCAAACAGCATGTCGATCCGGAGATCAAAATGGTCGAGTGGATGCAGACG
CTGAAGGAAACCGGGTTCGACATCCGGGCATATCGTGACGCGGCGGATCAGCGTGCGGATCTCCGCACGC
TGACGCCCGGGCCTGCTTCACAGGACGGGCCGGATGTGCAGCAGGCGGTGACACAGGCGATTGCCGGATT
AAGTGAACGAAAAGTGCAGTTCACGTACACGGACGTACTGGCCAGAACGGTCGGCATACTGCCGCCGGAA
AATGGTGTGATTGAACGGGCACGCGCCGGTATCGATGAGGCCATCAGCCGTGAGCAGCTTATCCCCCTCG
ACCGTGAGAAGGGGCTGTTCACGTCCGGGATTCATGTGCTCGATGAGCTGTCAGTCCGGGCACTCAGTCG
TGACATCATGAAACAGAACCGAGTGACCGTACATCCGGAGAAAAGTGTTCCCCGGACGGCCGGTTACAGC
GATGCCGTCAGCGTGCTGGCACAGGATCGCCCGTCGCTGGCCATTGTGTCCGGGCAGGGCGGTGCAGCCG
GGCAGCGTGAGCGGGTGGCTGAACTGGTCATGATGGCCCGGGAGCAGGGGCGGGAGGTGCAGATTATCGC
TGCTGACCGTCGCTCGCAGATGAACATGAAGCAGGATGAGCGTCTGTCCGGTGAGCTGATAACCGGGCGG
CGTCAGCTGCTGGAGGGCATGACCTTCACGCCGGGCAGTACCGTTATCGTCGACCAGGGCGAAAAACTCT
CCCTGAAAGAGACGTTAACTCTGCTGGACGGTGCCGCACGGCATAACGTACAGGTCCTGATAATCGACAG
CGGGCAGCGGACCGGTACCGGCAGTGCGCTGATGGCCATGAAGGATGCCGGAGTGAACACATATCGCTGG
CAGGGGGGAGAACAGCGACCGGCAACCATCATCAGTGAACCGGACCGTAATGTCCGCTATGCCCGGCTGG
CCGGAGATTTTGCGGTCAGCGTGAAAGCCGGAGAAGAGAGCGTGGCGCAGGTCAGTGGAGTACGGGAACA
GGCCATGCTGACTCAGACCATTCGCAGTGAGCTGAAAACACAGGGCGTACTCGGACATCCGGAGGTGACC
ATGACCGCGCTGTCACCGGTCTGGCTGGACAGCCGGAGTCGTTATCTGCGGGATATGTACCGCCCGGGGA
TGGTGATGGAGCAGTGGAACCCGGAGACACGCAGTCATGACCGCTATGTGATAGACCGGGTGACGGCGCA
GAGTCACAGCCTGACCCTGCGGGATGCGCAGGGCGAAACGCAGGTGGTGCGTATTTCTTCTCTGGACAGC
AGCTGGTCGCTGTTCCGGCCGGAAAAAATGCCGGTGGCAGACGGCGAGCGTCTGAGGGTGACAGGGAAAA
TTCCCGGACTCCGCGTCTCCGGCGGTGACCGCCTGCAGGTGTCGTCCGTCAGTGAGGACGCGATGACGGT
TGTTGTGCCGGGACGGGCTGAACCGGCCACCCTGCCTGTGAGCGATTCACCGTTCACGGCACTGAAGCTG
GAGAACGGCTGGGTGGAAACGCCCGGGCATTCCGTCAGCGACAGTGCGACGGTTTTTGCCTCCGTCACAC
AGATGGCAATGGACAATGCCACCCTGAACGGTCTGGCCCGCAGTGGTCGTGATGTCCGGCTGTATTCCTC
ACTGGATGAAACCCGTACTGCGGAAAAACTTGCCCGCCATCCGTCCTTTACGGTGGTTTCTGAGCAGATA
AAGACGCGGGCCGGTGAGACATCGCTGGAAACGGCTATCAGTCATCAGAAGTCCGCACTTCACACGCCGG
CACAGCAGGCCATTCATCTTGCCCTTCCGGTGGTGGAAAGTAAAAAACTGGCCTTCAGCATGGTGGACCT
GCTGACAGAGGCAAAGTCGTTTGCTGCAGAAGGAACCGGTTTTACTGAACTGGGAGGGGAAATCAATGCG
CAGATAAAACGGGGTGATTTACTGTATGTGGATGTGGCAAAAGGCTATGGCACAGGTCTGCTGGTTTCCC
GTGCGTCGTATGAGGCAGAAAAGAGCATTCTTCGCCATATTCTCGAAGGTAAGGAGGCAGTCATGCCGCT
GATGGAGAGAGTACCTGGCGAACTCATGGAGAAACTGACATCAGGACAGCGTGCCGCCACCCGCATGATA
CTGGAAACGTCCGACCGTTTCACGGTGGTACAGGGCTATGCCGGTGTGGGTAAGACCACACAGTTCCGGG
CGGTGATGTCAGCCGTGAACATGCTGCCGGAGAGTGAGCGTCCCCGAGTCGTGGGGCTGGGTCCCACACA
CCGTGCGGTCGGGGAGATGCGCAGCGCCGGCGTGGATGCGCAGACACTGGCGTCCTTTCTGCATGACACG
CAGCTGCAGCAGCGCAGCGGAGAAACGCCGGATTTCAGCAACACGCTGTTCCTGCTCGATGAGAGCTCAA
TGGTGGGCAATACCGACATGGCACGGGCATACGCCCTGATTGCGGCCGGTGGCGGTAGGGCGGTGGCCAG
TGGTGACACGGACCAGCTGCAGGCCATCGCGCCCGGTCAGCCTTTCCGTCTCCAGCAGACGCGCAGTGCT
GCCGATGTGGCCATCATGAAGGAGATTGTGCGTCAGACGCCGGAACTGCGGGAGGCGGTATACAGCCTGA
TTAACCGGGATGTGGAAAGGGCACTGTCCGGGCTTGAGAGTGTGAAACCGTCTCAGGTGCCACGTCAGGA
GGGCGCATGGGCACCGGAGCACTCCGTGACGGAGTTCAGTCACAGCCAGGAAGCGAAACTGGCAGAAGCG
CAGCAGAAGGCGATGCTGAAAGGCGAGGCTTTTCCGGATGTCCCCATGACACTGTATGAAGCCATTGTCC
GCGACTATACCGGCAGAACACCGGAAGCACGGGAGCAGACGCTGATTGTCACGCACCTGAATGAGGACCG
GCGCGTACTGAACAGCATGATTCATGATGTACGGGAAAAGGCCGGTGAGCTGGGGAAAGAGCAGGTCATG
GTGCCTGTCCTGAACACAGCGAATATACGTGACGGGGAGCTGCGTCGTCTCTCCACCTGGGAGACACATC
GGGACGCACTTGTCCTGGTGGATAATGTGTATCACCGGATTGCCGGTATCAGTAAGGATGACGGGCTGAT
AACCCTGCAGGATGCGGAAGGTAACACGCGGCTGATTTCTCCCCGGGAGGCGGTGGCTGAAGGTGTCACA
CTGTACACCCCGGACACCATCAGGGTGGGGACCGGTGACCGGATGCGCTTCACGAAGAGTGACCGGGAGC
GCGGTTATGTGGCCAACAGCGTCTGGACGGTGACAGCAGTTTCCGGTGACAGTGTCACGCTGTCGGACGG
ACAGCAGACCCGGGAGATTCGCCCCGGCCAGGAGCAGGCAGAGCAACATATTGACCTGGCCTATGCCATC
ACCGCTCACGGTGCGCAGGGGGCAAGTGAAACCTTTGCCATTGCGCTTGAAGGAACGGAAGGTAACCGGA
AACTGATGGCCGGCTTTGAGTCAGCCTACGTGGCCCTGTCGCGTATGAAGCAGCATGTGCAGGTGTACAC
CGATAACCGTCAGGGCTGGACGGATGCCATTAACAATGCCGTACAGAAAGGAACGGCCCACGATGTATTT
GAGCCGAAACCGGACCGGGAGGTCATGAATGCAGAGCGGCTGTTCAGTACGGCGCGGGAACTGCGGGACG
TGGCGGCAGGGCGTGCTGTTCTCCGTCAGGCGGGGCTGGCCGGGGGAGACAGTCCGGCACGGTTTATTGC
ACCGGGGCGCAAATATCCGCAGCCGTATGTGGCACTGCCGGCGTTTGACCGTAACGGCAAGTCAGCAGGT
ATCTGGCTGAACCCACTGACCACGGATGACGGAAACGGGCTGCGGGGATTCAGTGGTGAAGGACGGGTGA
AAGGCAGCGGGGATGCGCAGTTCGTGGCCCTGCAGGGCAGCCGTAACGGAGAGAGCCTGCTGGCTGATAA
TATGCAGGATGGTGTCCGGATTGCCCGTGATAATCCTGACAGCGGTGTGGTGGTGAGAATCGCCGGTGAA
GGTCGTCCGTGGAATCCCGGTGCCATCACCGGTGGTCGCGTGTGGGGGGATATCCCGGACAACAGTGTCC
AGCCGGGAGCCGGAAATGGCGAACCGGTCACGGCAGAGGTGCTGGCACAGCGGCAGGCTGAAGAGGCCAT
CCGTCGTGAAACGGAACGCCGCGCAGATGAAATTGTCCGTAAAATGGCAGAGAACAAACCTGACCTGCCG
GATGGCAAAACAGAGCAGGCTGTCAGGGAGATTGCCGGGCAGGAGCGTGACCGGGCTGCCATAACTGAAC
GGGAAGCCGCGCTGCCGGAGGGTGTACTGCGTGAACCTCAACGGGTGCGGGAAGCTGTCAGGGAAATTGC
CCGGGAAAATCTGCTGCAGGAGCGACTTCAGCAGATGGAGCGGGATATGGTCCGCGACCTGCAGAAAGAG
AAAACCCTGGGTGGAGACTGA
 Primer design