SecReT4
Protein ID: 32470012
T4SS name [ID]Tra_F [104]
Gene symboltraX
Locus tagp165897_040
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]33949..34695 [+]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDQ84A20
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 7.5e-51, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|32470012|ref|NP_862952.1| conjugal transfer pilus acetylation protein TraX [Escherichia coli]
MTTDNTNTTRNDSLVARTDTWLQSLLVWSPGQRDIIKTVALVLMVLDHANRILHLDQSWMFLAGRGAFPL
FALVWGLNLSRHAHIRQLAINRLWGWAVFSQFWYYFAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAA
AILMMALWGPLSGTSYGIAGLLMLAVSHRLYRAEDRMERLVLVACLLAVIPALNLATSDAAAVAGLVMTV
LTVGLVSCAGKSLPRFWPGDFFPTFYACHLAVLGVLAL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|32469973|ref|NC_004998.1|:33949-34695 Escherichia coli plasmid p1658/97, complete sequence
ATGACAACGGATAACACGAACACGACACGTAACGATTCACTGGTTGCCCGGACCGATACCTGGTTGCAGT
CGTTGCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTTCTGGA
CCATGCAAACCGTATTCTGCATCTGGACCAGTCGTGGATGTTTCTGGCCGGGCGCGGGGCCTTTCCGCTG
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATGCGCATATCCGGCAACTGGCCATTAACCGGCTGT
GGGGATGGGCAGTTTTTTCCCAGTTCTGGTATTACTTTGCCGGCTTTCCCTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTGGCGGCACAGGTGCTGACATGGTGTGAAACGCGCAGTGGGTGGCGTACTGCAGCG
GCCATTCTCATGATGGCACTGTGGGGGCCTTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCTGTCAGCCACCGGCTGTACCGTGCGGAAGACAGAATGGAACGTCTGGTGCTTGTCGCTTGCCTGCT
GGCCGTGATTCCGGCGCTTAACCTTGCCACCAGTGATGCCGCGGCGGTGGCCGGCCTTGTGATGACGGTG
CTGACCGTTGGTCTGGTGTCCTGTGCAGGGAAATCATTACCCCGTTTCTGGCCCGGAGATTTTTTCCCGA
CGTTCTATGCCTGTCATCTGGCTGTGCTGGGCGTTCTGGCGCTGTAA
 Primer design