SecReT4
Protein ID: 32470232
T4SS name [ID]Tra_I [173]
Gene symboltraM
Locus tagR64_p101
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid R64 (NC_005014)
Repliconplasmid R64 [GenBank: NC_005014] [Browse all T4SS(s) in this replicon]
Location [Strand]90519..91211 [-]
Producthypothetical protein
Component typeTraM_I
UniProt IDQ79VT8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 2e-34, Aligned region: 77..184
Protein Sequence: 230 a.a.     [Download]
>gi|32470232|ref|NP_863456.1| hypothetical protein R64_p101 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTENTEPSSPSHPAPDPEILKSTIRAMKQSEQRANNVPALIKALLCTGTCLLISITGNAIQYWHSTNVER
EYFATDNGRLVRLAPTNQPAWSQNDAMAFGSQALATAFNLDFVHYRSQISSLSPRFSDEGFAGYVNALQA
SNILETIKKEKMNLTATTGAGVLVRQGQMSDGVWFWTFQYPVRMRLVGQTTSKPEQSFVFEITIQRVDPR
LKPSGMEIRQMISRNAGPNS
 
Nucleotide Sequence: 693 bp     [Download]
>gi|32470134|ref|NC_005014.1|:c91211-90519 Salmonella enterica subsp. enterica serovar Typhimurium plasmid R64, complete sequence
ATGACCGAAAATACCGAGCCATCCTCGCCATCACATCCGGCACCTGACCCGGAAATACTGAAGAGCACAA
TCAGGGCTATGAAGCAGTCAGAACAGCGGGCAAATAATGTCCCTGCGCTGATAAAAGCGCTTTTATGTAC
GGGCACATGTCTTCTTATCAGTATTACTGGTAACGCCATTCAGTACTGGCACTCAACGAATGTGGAGCGC
GAATATTTCGCTACAGACAATGGTCGTCTGGTCAGGCTGGCACCAACAAATCAGCCAGCATGGAGTCAGA
ATGACGCAATGGCCTTTGGCAGCCAGGCACTGGCGACCGCATTCAACCTGGATTTTGTGCACTATCGTTC
ACAGATTTCCTCTCTGTCTCCGCGTTTTTCTGACGAAGGTTTTGCCGGATATGTGAATGCATTACAGGCA
TCTAACATTCTGGAGACGATCAAGAAAGAGAAGATGAATCTGACCGCCACGACAGGCGCTGGCGTTCTGG
TACGACAGGGACAAATGTCCGACGGCGTATGGTTCTGGACATTTCAGTATCCTGTCCGTATGCGTCTGGT
CGGCCAGACAACCAGCAAGCCAGAACAGTCTTTTGTTTTCGAAATCACCATCCAGCGTGTTGACCCCAGA
CTGAAACCATCCGGTATGGAAATCCGGCAGATGATCTCCCGTAACGCCGGACCGAACTCCTGA
 Primer design