SecReT4
Protein ID: 32470233
T4SS name [ID]Tra_I [173]
Gene symboltraL
Locus tagR64_p102
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid R64 (NC_005014)
Repliconplasmid R64 [GenBank: NC_005014] [Browse all T4SS(s) in this replicon]
Location [Strand]91208..91555 [-]
Producthypothetical protein
Component typeTraL_I
UniProt IDQ79VT7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 115 a.a.     [Download]
>gi|32470233|ref|NP_863457.1| hypothetical protein R64_p102 [Salmonella enterica subsp. enterica serovar Typhimurium]
MNMHKSLVAVLGLILISSTASAATCRAGSAAQAGSNTGYERARAAADAWSQRENDVSSSLQSCLSRIKKI
SINLPQFPSLDDILSQLENQVCDAVVDKVNEKLPGNIDPWKDYNL
 
Nucleotide Sequence: 348 bp     [Download]
>gi|32470134|ref|NC_005014.1|:c91555-91208 Salmonella enterica subsp. enterica serovar Typhimurium plasmid R64, complete sequence
ATGAACATGCATAAGTCTCTGGTTGCCGTGCTCGGCCTTATCCTGATTTCATCCACGGCAAGTGCTGCAA
CCTGTCGTGCGGGTAGCGCGGCACAGGCCGGTAGTAATACAGGATATGAGCGAGCACGTGCAGCTGCGGA
TGCATGGTCACAACGTGAAAACGATGTTTCCTCATCCCTGCAGTCCTGTCTGTCACGAATCAAAAAAATC
AGCATAAACCTCCCCCAGTTCCCCAGCCTTGACGACATTCTGTCGCAGCTGGAAAACCAGGTCTGCGACG
CGGTCGTGGACAAGGTGAATGAAAAGCTGCCGGGGAATATTGATCCCTGGAAGGACTACAACCTATGA
 Primer design