SecReT4
Protein ID: 325113146
T4SS name [ID]VirB [22]
Gene symbolvirB8
Locus tagACMV_P1_01540
StrainAcidiphilium multivorum AIU301
Repliconplasmid pACMV1 [GenBank: NC_015178] [Browse all T4SS(s) in this replicon]
Location [Strand]144959..145660 [+]
Producttype IV secretion system VirB8
Component typeVirB8
UniProt IDF0J783
KEGG IDamv:ACMV_P1_01540
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.9e-50, Aligned region: 24..231
Protein Sequence: 233 a.a.     [Download]
>gi|325113146|ref|YP_004277092.1| type IV secretion system VirB8 [Acidiphilium multivorum AIU301]
MNADMKNTALPIDNERLAAYFQDVESFQATEKRTARRWGRVGWVVAGVSLAVNVTLAGAIVMILPLEKLV
PAFITVKSDGTTSTTMNFNSLPSDEKAAMTRAAIWQYVRARESYDFADAQYRYDVASLMSNPTVQGTYQS
WFLDKGPGSTSPQVTVGKKGQISVEMVSLSMVRPNVALVRFRRTVTMYGSDPQTSTWTATVGFENVASLP
VSARLADPSGLIVTNYQAQKDSP
 
Nucleotide Sequence: 702 bp     [Download]
>gi|325112992|ref|NC_015178.1|:144959-145660 Acidiphilium multivorum AIU301 plasmid pACMV1, complete sequence
ATGAACGCGGACATGAAAAACACGGCTTTGCCGATCGATAACGAACGGCTCGCCGCTTATTTCCAGGATG
TCGAATCCTTCCAGGCCACTGAGAAGCGCACAGCCCGCCGCTGGGGCCGTGTGGGCTGGGTGGTGGCCGG
CGTGTCCCTGGCGGTCAACGTGACCCTCGCGGGGGCAATCGTGATGATCCTGCCCCTCGAAAAGCTCGTG
CCCGCCTTCATCACCGTGAAGTCAGACGGCACCACCAGCACCACCATGAATTTCAACAGCCTTCCCAGCG
ATGAGAAGGCGGCGATGACCAGGGCAGCGATCTGGCAATATGTCCGTGCCCGGGAAAGCTATGACTTCGC
CGACGCCCAATATCGGTATGATGTTGCCTCGCTGATGTCCAACCCCACGGTGCAAGGCACCTACCAAAGC
TGGTTCCTCGATAAAGGGCCAGGCAGCACCAGCCCGCAGGTCACGGTCGGTAAAAAGGGGCAGATCAGCG
TCGAGATGGTGAGCCTGTCCATGGTGCGGCCGAATGTCGCGCTGGTGCGCTTCCGCCGCACCGTGACGAT
GTACGGCTCAGATCCGCAGACTTCGACATGGACGGCAACGGTCGGCTTTGAAAACGTCGCATCCCTGCCG
GTTTCCGCCCGCCTCGCAGACCCCAGCGGGCTCATTGTGACCAACTACCAGGCCCAAAAGGATTCGCCAT
GA
 Primer design