SecReT4
Protein ID: 325113152
T4SS name [ID]VirB [22]
Gene symbolvirB11
Locus tagACMV_P1_01600
StrainAcidiphilium multivorum AIU301
Repliconplasmid pACMV1 [GenBank: NC_015178] [Browse all T4SS(s) in this replicon]
Location [Strand]151297..152364 [+]
Producttype IV secretion system VirB11
Component typeVirB11
UniProt IDF0J789
KEGG IDamv:ACMV_P1_01600
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.6e-60, Aligned region: 25..321
Protein Sequence: 355 a.a.     [Download]
>gi|325113152|ref|YP_004277098.1| type IV secretion system VirB11 [Acidiphilium multivorum AIU301]
MNGTDFSDDLVAESPAAPLLRFLLAPLQPWLNDGATEELCINRPGECWVRQRGVFERFKVPLDRSALEDI
AVLAGALRRQDVGPTSPLCSTELPGGERLQICLPPAVPTGTVSLTIRRPGSTVAPLSSVTSRYQSDGWNS
WAENRDTRNFAEALDYYDSGDLEGFLAAAVRCRMTILLCGATGSGKTTMSKTLISAIPMAERIITIEDTA
ELVIPQPNHVRLLYSKDGLSTAKIDAEALLQASLRMRPDRVLLQELRDDAAWTYVNEVVSGHPGSITTIH
GANPAQAFKKLFSLIKGSPKGASFDDATLCDLLAAAVDLIIPFETSGTTYRIGKVWFGPDATRRGETAAA
LLRAA
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|325112992|ref|NC_015178.1|:151297-152364 Acidiphilium multivorum AIU301 plasmid pACMV1, complete sequence
ATGAACGGCACCGATTTTTCCGATGACCTCGTGGCGGAAAGCCCGGCCGCGCCGCTGCTCCGCTTCCTGC
TCGCCCCGCTGCAACCCTGGCTGAACGATGGGGCCACTGAGGAGCTGTGCATCAACCGGCCCGGCGAGTG
CTGGGTGCGCCAGCGCGGCGTTTTTGAGCGGTTCAAGGTGCCCCTCGATCGCTCGGCGCTGGAGGATATT
GCCGTGCTCGCCGGCGCGCTGCGCCGTCAGGATGTCGGCCCTACCTCGCCGCTTTGCTCCACCGAACTGC
CAGGCGGCGAACGGCTGCAAATCTGCCTGCCGCCGGCCGTGCCCACCGGTACGGTCAGCCTGACAATCCG
CCGGCCGGGCTCGACGGTCGCGCCGCTCTCCTCCGTCACCTCCAGGTATCAGTCGGACGGATGGAACAGT
TGGGCGGAAAACCGGGACACCCGGAATTTCGCGGAAGCCCTGGACTACTACGATTCCGGCGATCTTGAGG
GCTTCCTTGCGGCGGCCGTGCGCTGCCGCATGACCATCCTGCTCTGTGGCGCCACCGGCTCCGGCAAAAC
CACGATGAGCAAAACGCTGATCTCGGCGATCCCCATGGCAGAGCGGATCATCACGATCGAGGACACGGCG
GAGCTTGTGATCCCGCAACCGAATCATGTCCGGCTGCTCTACTCGAAAGACGGCCTCTCCACCGCGAAAA
TCGACGCCGAGGCGCTGCTGCAGGCCAGCCTGCGCATGCGGCCAGATCGGGTGCTCCTGCAAGAGCTCCG
CGACGATGCGGCATGGACCTATGTGAACGAGGTGGTTTCCGGGCATCCGGGCTCGATCACCACCATTCAC
GGCGCCAACCCGGCCCAGGCGTTCAAGAAGCTGTTTTCGCTCATCAAGGGATCCCCGAAGGGCGCTAGCT
TCGATGACGCCACGCTTTGCGATCTGCTTGCGGCGGCTGTCGATCTCATCATCCCGTTCGAGACTTCCGG
CACCACCTACCGGATCGGCAAGGTCTGGTTTGGCCCGGACGCGACCAGGCGCGGCGAAACAGCCGCCGCC
CTCTTGCGGGCCGCCTGA
 Primer design