SecReT4
Protein ID: 325113153
T4SS name [ID]VirB [22]
Gene symboltraG
Locus tagACMV_P1_01610
StrainAcidiphilium multivorum AIU301
Repliconplasmid pACMV1 [GenBank: NC_015178] [Browse all T4SS(s) in this replicon]
Location [Strand]152364..154184 [+]
Productputative conjugal transfer protein TraG
Component typeVirD4
UniProt IDF0J790
KEGG IDamv:ACMV_P1_01610
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.9e-81, Aligned region: 137..604
TraG-D_C [PF12696], Evalue: 4.9e-24, Aligned region: 435..562
TrwB_AAD_bind [PF10412], Evalue: 5.4e-14, Aligned region: 182..571
Protein Sequence: 606 a.a.     [Download]
>gi|325113153|ref|YP_004277099.1| putative conjugal transfer protein TraG [Acidiphilium multivorum AIU301]
MTWRGVMRLLVGLVLGLVFFSVLATMIFLIGTGLFWHFRHPFWQWWLYLFEASGDPTVRVWLVISGVPAF
AIPFLAGVVQLVRGRRVTGWSLRRDHAPTKPVDAPIRAPTDNHGHARWMTMEEARARFPGPAPEYGGLVV
GEAYEVHRDSVASMPFRPKDRSTWGQGGKAPLLIDPCEIGSTHCMMFAGSGGYKTTTAVSTLLTWTGSAI
VLDPSVELGPMLRQAREDMGHKVYMLDPRTAREVGFNVLDWVDVSSPLAEIDVQAVVEWVCGDTKAGGDE
NASFFKNSGKELVTALLAHMLWDEHLEPHEKTLRAVRAAIVTPEKELRNVLAHIHKNSQSRLARDLAGSL
KDIVDETFSGIYKNATQDTAWLSTAAYADLVSGNAFRCAELTLGKTTVFINIPLKALDATPAVARVITGA
LLNAAYEADGVIEGRVLFLLDEAARLGPMKILETARDCARKYKITLFPFYQSIGQLRELFGQNGPAKWFE
SVSWYGFAGVKTKAVAEELAAAIGEYGVLAWSEGSNTGNSAKGLEAGTRSTGQTKTYHELKRQLIRAEEI
MHDMRDDEQIIFPKSGRPLRCGRAIYFRRPEMAARVGENRFAVNAT
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|325112992|ref|NC_015178.1|:152364-154184 Acidiphilium multivorum AIU301 plasmid pACMV1, complete sequence
ATGACCTGGCGCGGCGTGATGCGGCTCCTCGTTGGGCTGGTGCTCGGCCTGGTGTTCTTCTCCGTCCTCG
CCACGATGATCTTCCTCATTGGAACCGGACTGTTCTGGCATTTCCGGCATCCGTTCTGGCAATGGTGGCT
CTATCTTTTCGAGGCCAGCGGAGATCCTACTGTACGGGTCTGGCTGGTCATCAGCGGCGTGCCGGCCTTC
GCGATCCCCTTCCTCGCCGGGGTCGTTCAGCTTGTGCGCGGCCGGCGCGTCACCGGCTGGTCACTGCGCC
GCGATCACGCCCCGACAAAGCCCGTCGATGCGCCGATCCGTGCCCCAACCGACAACCATGGTCATGCCCG
CTGGATGACGATGGAGGAGGCCCGCGCCAGGTTCCCGGGGCCAGCCCCGGAATATGGCGGGCTTGTCGTG
GGCGAAGCGTATGAGGTTCACCGCGACAGCGTTGCCAGTATGCCGTTCAGGCCGAAGGATCGTTCAACCT
GGGGGCAGGGGGGCAAGGCGCCCCTGCTGATCGATCCATGCGAGATTGGCTCGACCCATTGCATGATGTT
CGCCGGATCGGGCGGCTACAAGACGACGACGGCCGTCTCCACGCTGCTGACATGGACCGGCTCGGCCATT
GTCCTTGACCCCTCGGTGGAGCTGGGGCCGATGTTGCGCCAGGCGCGTGAGGACATGGGCCACAAGGTCT
ATATGCTCGATCCCCGCACGGCCCGCGAAGTCGGGTTCAATGTGCTCGACTGGGTCGATGTCTCCTCCCC
CCTCGCGGAAATCGATGTTCAGGCCGTGGTTGAGTGGGTTTGCGGCGATACCAAAGCAGGCGGCGATGAA
AACGCCTCCTTCTTCAAGAACAGCGGCAAGGAGCTGGTGACGGCGCTGCTCGCGCATATGCTCTGGGACG
AACACCTGGAACCGCACGAAAAGACCTTGCGCGCCGTCCGCGCGGCCATCGTTACGCCCGAAAAGGAGCT
GCGGAACGTCTTGGCCCATATTCACAAGAACTCGCAAAGCCGCCTCGCCCGCGATCTGGCCGGTAGCTTG
AAGGACATTGTGGATGAGACCTTTAGCGGCATCTACAAGAACGCCACCCAGGACACGGCCTGGCTTTCAA
CCGCCGCCTATGCGGATCTCGTCTCCGGCAATGCGTTCCGTTGCGCTGAGCTGACGCTCGGCAAGACCAC
GGTTTTCATCAACATTCCCCTCAAGGCGCTCGATGCCACCCCGGCCGTCGCCCGCGTCATCACCGGCGCG
CTGCTGAACGCGGCCTATGAAGCGGATGGCGTGATCGAAGGCCGCGTGTTGTTCCTGCTCGATGAGGCCG
CCCGGCTTGGCCCCATGAAAATCCTCGAAACCGCCCGCGACTGCGCCCGGAAATACAAGATCACGCTGTT
TCCGTTTTATCAGTCGATCGGCCAGCTTCGCGAGCTGTTCGGCCAGAACGGCCCGGCCAAGTGGTTTGAA
TCGGTCAGCTGGTATGGCTTCGCCGGCGTCAAAACCAAGGCCGTTGCCGAGGAGCTGGCTGCGGCGATCG
GCGAATATGGCGTGCTGGCCTGGTCGGAAGGCTCGAACACCGGCAACTCGGCAAAGGGCCTGGAAGCAGG
CACGCGCTCGACCGGCCAGACCAAAACCTATCATGAGCTGAAACGCCAACTCATCCGGGCCGAGGAAATC
ATGCACGACATGAGGGATGATGAGCAGATCATCTTCCCAAAATCCGGCCGGCCGCTGCGCTGCGGCCGGG
CCATTTATTTTCGGCGGCCTGAGATGGCCGCACGTGTGGGCGAGAACCGCTTTGCCGTCAACGCAACTTA
A
 Primer design