SecReT4
Protein ID: 325168612
T4SS name [ID]VirB [189]
Gene symbol-
Locus tagAGROH133_14658
StrainAgrobacterium sp. H13-3
Repliconplasmid pAspH13-3a [GenBank: NC_015184] [Browse all T4SS(s) in this replicon]
Location [Strand]286239..288158 [-]
Productconjugal transfer coupling protein TraG
Component typeVirD4
UniProt IDF0LG42
KEGG IDagr:AGROH133_14658
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.1e-92, Aligned region: 166..633
TraG-D_C [PF12696], Evalue: 2.7e-29, Aligned region: 473..596
TrwB_AAD_bind [PF10412], Evalue: 9.8e-22, Aligned region: 429..612
Protein Sequence: 639 a.a.     [Download]
>gi|325168612|ref|YP_004280402.1| unnamed protein product [Agrobacterium sp. H13-3]
MKGKAKPRPSLLLIIIPIAVTGFSFYVAHWRWPELATGITGKTQYWFLRASPLPVLLFGPLAGLLAVWAL
PLHRRRPVALASFLCFLLMAGFYGMREFGRLQPLVESGVLTWDQALSFVDMIAVVGAAMGFMAAAVAARI
SSVVPEQVTRARRGTFGDADWLPMSAAARLFPDDGEIVIGERYRVDKELVHELPFDPNDPATWGRGGKAP
LLTYSQDFDSTHMLFFAGSGGFKTTSNVVPTALRYTGPLICLDPSTEVAPMVVDHRRDKLNREVVVLDPA
NPVMGFNVLDGIEHSLKKEEDIVGIAHMLLSESLRFESSTGSYFQSQAHNLLTGLLAHVMLSPEYAGRRN
LRSLRQIVSEPETSVLAMLRDVQEHSASAFIRETLGVFVNMTEQTFSGVYSTASKDTQWLSLDNYAALVC
GNAFKSSEIAGGKKDVFINISASILRSYPGIGRVIIGSLINAMIEADGAFTRRALFILDEVDLLGYMRVL
EEARDRGRKYGVSMMLMYQSVGQLERHFGKDGAVSWIDGCAFASYAAIKALDTARNVSAQCGEMTVEVKG
SSRNLGWGTKNSASRKSESITFQRRPLIMPHEITQSMRKDEQIIIVQGHSPIRCGRAIYFRRKDMDRHAR
PNRFAKLGP
 
Nucleotide Sequence: 1920 bp     [Download]
>gi|325168279|ref|NC_015184.1|:c288158-286239 Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence
ATGAAGGGAAAGGCCAAACCTCGTCCAAGCCTCTTGCTTATCATCATTCCCATCGCCGTCACCGGTTTTT
CCTTTTACGTCGCCCACTGGCGTTGGCCTGAATTGGCGACCGGCATCACAGGCAAGACGCAATACTGGTT
CCTTCGGGCGTCACCGTTGCCCGTCCTTTTGTTCGGGCCGCTGGCTGGACTGCTGGCGGTCTGGGCGCTG
CCCCTCCATCGGCGAAGGCCCGTGGCATTGGCAAGCTTTCTCTGCTTTCTCCTGATGGCCGGCTTTTACG
GGATGCGCGAGTTCGGGCGGCTTCAGCCGCTCGTAGAGAGCGGTGTGCTGACCTGGGATCAGGCGCTATC
ATTCGTCGACATGATTGCGGTCGTTGGCGCAGCGATGGGATTCATGGCGGCCGCGGTCGCGGCGCGCATC
TCCAGCGTCGTGCCCGAACAGGTGACGCGCGCCAGGCGCGGAACATTCGGAGATGCAGACTGGCTGCCGA
TGTCGGCGGCGGCACGGCTGTTTCCCGATGATGGCGAAATCGTCATCGGCGAGCGCTACAGGGTCGACAA
GGAACTCGTCCATGAGTTGCCGTTCGATCCGAACGATCCGGCCACCTGGGGACGTGGTGGCAAAGCCCCG
CTGCTGACCTACTCCCAGGATTTCGATTCGACTCACATGCTTTTCTTCGCGGGCTCCGGTGGCTTCAAGA
CCACCAGCAACGTCGTGCCGACGGCGCTCAGATATACGGGTCCGCTCATTTGCCTGGATCCGTCCACCGA
GGTGGCCCCGATGGTCGTTGACCACCGAAGAGATAAACTCAACCGAGAGGTTGTTGTGCTCGATCCGGCA
AATCCGGTCATGGGATTTAACGTGCTCGACGGAATCGAGCACTCGCTAAAAAAGGAAGAGGACATTGTCG
GCATTGCGCACATGTTACTCTCGGAAAGCTTGCGCTTCGAATCGTCGACTGGCTCTTACTTCCAATCGCA
GGCGCACAATCTGCTGACTGGTCTTCTAGCGCATGTGATGCTGTCACCGGAATATGCAGGACGGCGAAAC
CTGCGCAGCCTGCGCCAGATCGTCTCCGAGCCGGAAACCTCCGTGCTTGCCATGCTGCGCGACGTACAGG
AACACTCCGCGTCCGCCTTCATCCGCGAAACGCTCGGCGTCTTTGTTAACATGACCGAGCAAACATTCTC
AGGCGTCTATTCGACGGCATCGAAGGATACGCAATGGCTGTCGCTCGATAATTACGCGGCACTGGTTTGC
GGCAACGCGTTCAAATCGAGCGAGATCGCTGGCGGAAAGAAAGACGTCTTTATCAATATCTCCGCATCGA
TCCTGCGGTCCTATCCCGGTATCGGTCGGGTGATCATCGGCTCGCTGATCAACGCGATGATCGAAGCGGA
TGGTGCGTTCACGAGGCGAGCGTTGTTCATTTTGGACGAAGTCGATCTGCTTGGCTACATGCGCGTGCTT
GAAGAGGCGCGCGATCGCGGTCGCAAGTATGGCGTTAGCATGATGCTGATGTACCAGTCCGTCGGGCAAC
TGGAACGGCACTTCGGAAAAGACGGTGCGGTGTCGTGGATCGACGGCTGCGCTTTCGCGAGTTACGCCGC
GATCAAGGCACTGGATACCGCCCGCAACGTCTCTGCCCAATGTGGAGAAATGACTGTCGAAGTCAAAGGC
AGTTCTCGCAATCTCGGCTGGGGTACGAAAAACAGTGCGTCGCGGAAATCCGAAAGCATCACTTTCCAGC
GCCGGCCGCTCATTATGCCGCACGAAATCACCCAATCGATGCGCAAGGACGAGCAGATCATCATCGTCCA
GGGCCACAGTCCGATCCGCTGCGGACGGGCGATCTATTTCAGGCGGAAGGACATGGATAGGCACGCCAGG
CCCAACAGGTTTGCCAAGCTGGGACCTTGA
 Primer design