SecReT4
Protein ID: 325168680
T4SS name [ID]VirB [189]
Gene symbol-
Locus tagAGROH133_14786
StrainAgrobacterium sp. H13-3
Repliconplasmid pAspH13-3a [GenBank: NC_015184] [Browse all T4SS(s) in this replicon]
Location [Strand]348857..349546 [+]
Producttype IV secretion protein AvhB1
Component typeVirB1
UniProt IDF0LGB0
KEGG IDagr:AGROH133_14786
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 229 a.a.     [Download]
>gi|325168680|ref|YP_004280470.1| unnamed protein product [Agrobacterium sp. H13-3]
MPVVFSDLAQTCAPFVASEALAGVVSPESRFAPFTIRINSRAPLGRQPATKADAIEVAASSEATCHDIHI
GPDGVGPEELRRLNLSIPAAFARCLNLNAPATPSDGYCCLSVKVGADSPRAEQVLQSCYGRDDPSVGGVV
NYGDQVRREIERLGPTVARFTIGDTGKGLQTNVSANSPQADVVAEVVAENTPGEAHAISAASAWDVFKTR
SRSSVLVFQDNQLELEQSE
 
Nucleotide Sequence: 690 bp     [Download]
>gi|325168279|ref|NC_015184.1|:348857-349546 Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence
ATGCCCGTTGTCTTCTCAGATCTTGCGCAGACCTGCGCACCCTTCGTTGCATCGGAGGCTCTTGCGGGTG
TGGTCAGCCCCGAAAGCCGGTTCGCTCCGTTCACCATCAGGATCAACAGCCGTGCACCGCTCGGGCGGCA
ACCTGCGACCAAGGCCGATGCAATCGAAGTCGCCGCATCCTCGGAGGCAACATGCCATGACATACACATT
GGTCCCGACGGGGTCGGGCCGGAAGAACTGCGGAGATTGAACCTCTCGATACCAGCCGCTTTCGCTCGCT
GCCTTAACCTGAATGCTCCAGCGACGCCATCCGACGGCTATTGCTGCCTCTCGGTGAAGGTTGGTGCTGA
CAGTCCCAGGGCCGAGCAGGTGCTGCAATCCTGCTATGGACGTGACGATCCGTCGGTCGGGGGCGTGGTC
AACTATGGCGATCAGGTTCGCCGCGAAATCGAACGGCTCGGACCAACAGTGGCTCGATTTACAATCGGCG
ACACGGGAAAAGGGTTGCAGACAAACGTGTCGGCGAATTCTCCCCAAGCAGACGTCGTTGCCGAAGTGGT
GGCGGAAAACACTCCGGGGGAAGCACACGCGATCTCGGCGGCGTCCGCGTGGGACGTCTTCAAGACCCGA
AGCCGTTCATCCGTCCTGGTGTTTCAAGACAATCAATTGGAATTGGAGCAGAGTGAATGA
 Primer design