SecReT4
Protein ID: 325168681
T4SS name [ID]VirB [189]
Gene symbol-
Locus tagAGROH133_14787
StrainAgrobacterium sp. H13-3
Repliconplasmid pAspH13-3a [GenBank: NC_015184] [Browse all T4SS(s) in this replicon]
Location [Strand]349543..349842 [+]
Producttype IV secretion protein AvhB2
Component typeVirB2
UniProt IDF0LGB1
KEGG IDagr:AGROH133_14787
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.4e-23, Aligned region: 11..96
Protein Sequence: 99 a.a.     [Download]
>gi|325168681|ref|YP_004280471.1| unnamed protein product [Agrobacterium sp. H13-3]
MIISSRIRPVVASSVMAAAIVVTMVEPAFAQAAGIETVLQNIVDMLTGNIAKLLAVIAVIVICIAWMFGY
MDLRRAGFWIIGIGGIFGATELVNTIVGA
 
Nucleotide Sequence: 300 bp     [Download]
>gi|325168279|ref|NC_015184.1|:349543-349842 Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence
ATGATAATCAGTTCCCGGATCAGACCCGTCGTCGCTTCGTCCGTCATGGCTGCCGCCATTGTAGTGACGA
TGGTTGAGCCCGCCTTCGCGCAAGCCGCCGGCATCGAAACCGTCCTGCAGAACATCGTCGACATGTTGAC
GGGAAACATTGCCAAGCTTCTCGCTGTGATTGCGGTCATCGTCATCTGCATCGCCTGGATGTTTGGTTAT
ATGGACCTGAGGCGAGCGGGCTTCTGGATCATCGGAATTGGCGGCATCTTTGGCGCCACCGAACTCGTCA
ACACCATCGTCGGAGCCTGA
 Primer design