SecReT4
Protein ID: 325168682
T4SS name [ID]VirB [189]
Gene symbol-
Locus tagAGROH133_14792
StrainAgrobacterium sp. H13-3
Repliconplasmid pAspH13-3a [GenBank: NC_015184] [Browse all T4SS(s) in this replicon]
Location [Strand]349845..350186 [+]
Producttype IV secretion protein AvhB3
Component typeVirB3
UniProt IDF0LGB2
KEGG IDagr:AGROH133_14792
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1.7e-19, Aligned region: 10..93
Protein Sequence: 113 a.a.     [Download]
>gi|325168682|ref|YP_004280472.1| unnamed protein product [Agrobacterium sp. H13-3]
MVGGQTVLEEDTLFIACTRPAMIAGVTMEAMGFNIMVTTILYIVAGSIAYAFVGIVFHLIFKALVKHDHN
MFRILLAWVETRGRSRNGAYWGGATLSPLRLTRRFDERDIGIA
 
Nucleotide Sequence: 342 bp     [Download]
>gi|325168279|ref|NC_015184.1|:349845-350186 Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence
ATGGTGGGCGGACAAACGGTTCTCGAAGAAGACACACTCTTCATCGCGTGTACGCGTCCCGCGATGATTG
CCGGTGTCACGATGGAGGCGATGGGCTTCAACATCATGGTCACGACGATCCTCTACATCGTCGCCGGATC
TATCGCCTACGCGTTCGTCGGCATCGTTTTCCATCTCATCTTCAAAGCGCTCGTCAAGCACGATCACAAC
ATGTTCCGCATCCTGCTCGCCTGGGTCGAGACACGCGGCCGTTCACGCAACGGTGCCTATTGGGGCGGGG
CAACACTTTCCCCTCTGAGACTGACACGCCGCTTCGACGAAAGGGATATTGGAATTGCCTGA
 Primer design