SecReT4
Protein ID: 325168683
T4SS name [ID]VirB [189]
Gene symbol-
Locus tagAGROH133_14794
StrainAgrobacterium sp. H13-3
Repliconplasmid pAspH13-3a [GenBank: NC_015184] [Browse all T4SS(s) in this replicon]
Location [Strand]350179..352560 [+]
Producttype IV secretion protein AvhB4
Component typeVirB4
UniProt IDF0LGB3
KEGG IDagr:AGROH133_14794
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.4e-61, Aligned region: 177..380
AAA_10 [PF12846], Evalue: 2.6e-31, Aligned region: 433..716
Protein Sequence: 793 a.a.     [Download]
>gi|325168683|ref|YP_004280473.1| unnamed protein product [Agrobacterium sp. H13-3]
MPDIATLRSRELTPEAFIPYVRHIDETTIALESRTLMVMVALAGVSFETADLLDINALHRDLNTLYRNIA
DERLAIWTHLIRRRDSDYPGGTFATPFSASLNEKYRERMAREHLFRNDLYLTVLWSPARGPADKAGKLLS
YLRRSKRLDMELDEEALKQLKDKVVNVVAGLRRFEPRVLSLYEQEGMLFSEPSEVLHQLVGGRRERVPLT
EGRVASAIYSDRVIIGRETIEIRHEAESRFAGMLSFKEYPARTRTGMLDGVLNSPFELILSQSFCFVSKA
DARVIMGRKQNQLVSSGDKAASQIDELDDAMDDLESNRFVIGEHHLTLSVFATTLKELTDNLAKVRASLT
NGGAVVAREDLGLEAAWWAQLPGNFRYRARSGAISSKNFAALSPFHSYPIGQKDGNEWGPAVALLKTASG
SPYYFNLHYGDLGNTFMCGPSGAGKTVIVNFMLSQLEKHDPHVVFFDKDRGADLYVRAAGGTYLPLKNGV
PTGCAPLKALNLTPENKVFLARWIGKLVGSGARELTVTELRDISGAIDGLADLPAERRTIGALRAFLNNT
DPEGIAARLRRWEEGGPLGWVFDNVIEDIGFGDFGGSGKFIGYDMTDFLDNEEIRTPLMAYLFHRVEQMI
DGRRIIIVIDEFWKALQDEGFRDLAQNKLKTIRKQNGLMLFATQSPRDALNSPIAHTIIEQCPTQIFLPN
SRGNHADYVDGFKLTEREYELIARELSVESRRFVLKQGHNSVVAELDLNGFDDELAILSGRTANVELLDA
IRAEVGDDVENWLPIFQQRRSAS
 
Nucleotide Sequence: 2382 bp     [Download]
>gi|325168279|ref|NC_015184.1|:350179-352560 Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence
TTGCCTGACATCGCCACCCTTAGATCACGCGAACTCACGCCAGAGGCTTTTATCCCTTACGTGCGGCACA
TCGACGAGACGACAATCGCGCTCGAGTCCCGGACACTCATGGTCATGGTCGCGCTCGCAGGCGTATCGTT
CGAAACTGCTGATCTGCTCGACATCAACGCGCTCCATCGCGACCTCAACACGCTCTATCGAAATATTGCC
GATGAGCGGCTCGCGATCTGGACCCATCTCATTCGGCGCAGGGATAGCGACTATCCGGGCGGAACGTTCG
CAACGCCATTCTCCGCCTCGCTCAACGAGAAATACCGGGAACGCATGGCGCGCGAACACCTTTTCCGCAA
CGATCTCTATCTGACCGTCCTTTGGTCGCCAGCGCGTGGCCCTGCAGACAAGGCGGGGAAGCTGCTGTCG
TACCTTCGACGGTCAAAACGACTCGATATGGAGCTGGATGAAGAGGCTCTGAAACAGCTTAAGGACAAAG
TCGTCAACGTAGTGGCGGGCTTGAGGCGCTTTGAGCCACGGGTCCTTTCTCTTTACGAACAGGAAGGCAT
GCTCTTCTCTGAACCGAGCGAGGTGCTGCACCAGCTCGTCGGCGGGAGGCGTGAGCGTGTGCCGCTTACC
GAAGGTCGCGTCGCCTCGGCAATTTACTCTGATCGCGTAATCATAGGTCGGGAAACGATCGAGATCCGGC
ATGAGGCAGAAAGCCGCTTTGCCGGCATGCTGAGCTTCAAGGAATATCCAGCCCGCACCAGGACAGGCAT
GCTGGACGGAGTTCTAAATAGTCCGTTTGAGCTCATTCTCTCACAGTCGTTCTGCTTTGTGTCGAAGGCG
GACGCTCGCGTCATCATGGGGCGTAAGCAAAACCAGTTGGTGAGCAGCGGCGACAAGGCGGCTTCGCAAA
TCGATGAACTTGACGATGCGATGGACGACCTGGAGTCCAACCGCTTCGTGATCGGCGAGCATCACCTGAC
ACTCTCCGTCTTTGCGACCACGTTAAAGGAATTAACCGACAATCTGGCAAAGGTTCGCGCCAGCCTGACC
AATGGCGGGGCTGTCGTTGCGCGCGAGGATCTTGGTCTCGAAGCGGCATGGTGGGCGCAACTTCCGGGCA
ATTTTCGTTACCGCGCGCGCTCAGGCGCGATCAGCTCGAAGAATTTCGCAGCATTGTCACCGTTCCATTC
CTATCCGATCGGACAGAAGGACGGCAATGAGTGGGGACCCGCCGTCGCCCTGCTCAAGACCGCTTCAGGC
TCGCCCTACTACTTCAATCTCCATTATGGCGATCTGGGCAACACCTTCATGTGCGGTCCGTCGGGAGCGG
GCAAAACCGTGATTGTCAATTTCATGCTGTCACAGCTCGAGAAACACGACCCGCACGTGGTGTTCTTCGA
CAAGGATCGCGGCGCGGACCTTTATGTTCGCGCCGCCGGAGGCACCTACCTGCCGCTGAAGAACGGGGTC
CCCACCGGCTGCGCTCCCTTAAAGGCCCTCAACCTGACGCCGGAGAACAAGGTGTTCCTGGCGCGCTGGA
TCGGCAAGCTTGTGGGTTCAGGGGCGCGGGAACTGACTGTCACCGAACTTCGCGACATCTCCGGCGCGAT
CGACGGCCTTGCCGACCTGCCCGCTGAGCGACGGACAATAGGGGCGCTGCGGGCTTTCCTCAACAATACG
GATCCGGAAGGTATCGCGGCGAGGCTCCGCCGGTGGGAGGAGGGAGGGCCGCTCGGCTGGGTCTTCGACA
ATGTCATCGAAGATATCGGATTTGGGGATTTCGGCGGATCAGGGAAGTTCATCGGCTACGACATGACCGA
CTTCCTCGACAACGAGGAAATTCGCACACCGCTGATGGCCTATCTCTTCCATCGCGTCGAGCAGATGATC
GATGGCCGCCGGATCATCATCGTCATCGACGAATTCTGGAAGGCGCTACAGGACGAGGGGTTCCGCGATC
TTGCGCAAAACAAGCTGAAGACCATCCGCAAACAAAATGGGTTGATGCTGTTTGCCACGCAAAGCCCGCG
CGACGCGCTGAACTCGCCAATCGCGCACACGATCATCGAGCAATGCCCGACACAGATCTTCCTGCCCAAC
TCGCGCGGCAACCATGCCGACTATGTCGATGGATTCAAGCTCACCGAGCGCGAATACGAATTGATAGCGC
GCGAGCTTTCCGTTGAAAGCCGGAGGTTCGTGTTGAAGCAAGGACACAACAGCGTCGTTGCCGAGCTCGA
TCTCAACGGCTTCGATGACGAGCTCGCCATCCTCTCCGGCCGGACCGCCAATGTCGAACTTCTCGACGCG
ATCCGCGCGGAGGTTGGAGACGACGTCGAGAACTGGCTTCCCATTTTCCAACAGCGAAGGAGTGCTAGCT
GA
 Primer design