SecReT4
Protein ID: 325168684
T4SS name [ID]VirB [189]
Gene symbol-
Locus tagAGROH133_14795
StrainAgrobacterium sp. H13-3
Repliconplasmid pAspH13-3a [GenBank: NC_015184] [Browse all T4SS(s) in this replicon]
Location [Strand]352560..353258 [+]
Producttype IV secretion protein AvhB5
Component typeVirB5
UniProt IDF0LGB4
KEGG IDagr:AGROH133_14795
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 3.1e-54, Aligned region: 26..218
OmpH [PF03938], Evalue: 2.2e-05, Aligned region: 13..232
Protein Sequence: 232 a.a.     [Download]
>gi|325168684|ref|YP_004280474.1| unnamed protein product [Agrobacterium sp. H13-3]
MTSYRLHGVLLSAVLMLAAEGASGQGIPVNDQAAIAKQIESIAQLKSQLDALNEQIGQARQLYGSLNKLT
DMADVAEVLNDPAIRKALPSDFAAIEGLLKGNGTGVFGDSASRFLEGNSTYRTDADDFYAQELSRLQNKN
AGQMSLGEQIYDAATKRINGIDQLRGKISTAGDAKEIADLQARLQAEQAFLQTDVLRMEGLRMVQQAQNQ
VDEQRKAEDWRQRMDNMKAALQ
 
Nucleotide Sequence: 699 bp     [Download]
>gi|325168279|ref|NC_015184.1|:352560-353258 Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence
ATGACTTCCTATCGACTTCATGGCGTACTGCTCAGCGCGGTGCTCATGCTTGCCGCTGAAGGCGCGTCAG
GGCAGGGGATTCCTGTCAACGATCAGGCTGCGATTGCCAAGCAGATCGAGAGCATCGCGCAGCTCAAGTC
GCAACTCGACGCGCTCAATGAGCAGATCGGCCAGGCTCGGCAGCTTTATGGCTCGCTCAACAAGCTGACC
GATATGGCGGATGTCGCCGAGGTTCTCAACGATCCGGCGATCCGCAAGGCGCTTCCCTCCGACTTCGCTG
CCATCGAGGGATTGCTCAAAGGCAACGGTACCGGCGTGTTCGGTGATTCCGCCTCAAGGTTTCTGGAAGG
TAACTCGACCTACCGCACTGACGCCGATGATTTCTACGCTCAGGAATTGTCCCGGCTTCAGAACAAGAAT
GCCGGGCAAATGAGCCTTGGTGAGCAAATCTACGATGCCGCGACCAAGCGCATCAACGGGATTGATCAGC
TGCGGGGAAAGATTTCCACGGCTGGCGACGCCAAAGAGATTGCCGACCTGCAGGCTCGGCTGCAGGCCGA
ACAGGCATTTCTTCAGACCGACGTCCTGCGGATGGAGGGGCTGAGGATGGTGCAGCAGGCGCAGAACCAG
GTCGACGAACAGCGCAAGGCGGAGGACTGGCGCCAACGGATGGACAATATGAAGGCGGCGCTGCAGTGA
 Primer design