SecReT4
Protein ID: 325168686
T4SS name [ID]VirB [189]
Gene symbol-
Locus tagAGROH133_14798
StrainAgrobacterium sp. H13-3
Repliconplasmid pAspH13-3a [GenBank: NC_015184] [Browse all T4SS(s) in this replicon]
Location [Strand]353493..354428 [+]
Producttype IV secretion protein AvhB6
Component typeVirB6
UniProt IDF0LGB6
KEGG IDagr:AGROH133_14798
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.4e-54, Aligned region: 39..260
Protein Sequence: 311 a.a.     [Download]
>gi|325168686|ref|YP_004280476.1| unnamed protein product [Agrobacterium sp. H13-3]
MYQVFEFIDGQFKRPLETFVSDGTSNIAEWVAGPLTVAVTLYVVLYGYLILRGSVQEPILDFAFRAMKLA
IIVMLVKNAGEYQTYVTNIFFDVLPREIAQALNAGTAPSASTFDSLLDKGQASATDIWTRASWPIDIVTG
VGGIMVIGVSFLVAGIGYVVSLYARLALAIVLAIGPIFIALAMFQSTRRFTESWIGQLANFVILQVLVVA
VGSLLISCLDSSFTAIDSYSDVLMRPIAFCAIGIAALYIFYQLPGIASALASGGASLVYGYTTARDAHEG
MLARAASHTGRMIGRGARFARRAFGSRNAGV
 
Nucleotide Sequence: 936 bp     [Download]
>gi|325168279|ref|NC_015184.1|:353493-354428 Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence
ATGTACCAGGTGTTTGAGTTTATCGACGGTCAGTTCAAGCGGCCGTTGGAGACTTTCGTCTCGGATGGGA
CGTCGAACATAGCAGAATGGGTCGCTGGTCCGTTGACGGTGGCAGTGACCCTCTACGTCGTCCTCTACGG
CTATCTCATCCTTCGGGGCTCGGTCCAGGAACCTATCCTTGACTTCGCCTTCCGCGCGATGAAGCTCGCG
ATCATAGTGATGCTGGTGAAGAACGCCGGCGAATATCAGACCTATGTCACAAACATCTTCTTCGATGTTT
TGCCACGCGAGATCGCTCAGGCGCTGAATGCAGGTACGGCGCCGAGTGCCAGCACCTTTGACAGTCTGCT
CGACAAGGGCCAGGCCTCTGCGACCGATATCTGGACCAGGGCTTCCTGGCCGATTGACATCGTCACAGGT
GTGGGCGGCATCATGGTGATCGGCGTCAGCTTTCTGGTGGCGGGGATCGGTTATGTTGTTTCCCTTTATG
CACGGTTGGCGCTGGCGATCGTCCTGGCGATCGGGCCGATTTTCATTGCGCTTGCCATGTTTCAATCGAC
GCGCCGTTTTACCGAGTCCTGGATCGGGCAGCTCGCAAACTTCGTGATCCTTCAGGTCCTTGTCGTTGCC
GTCGGTTCACTTTTGATCTCCTGCCTGGACTCGAGCTTCACCGCAATCGACAGCTACAGCGACGTCCTTA
TGCGCCCTATTGCTTTTTGTGCCATCGGGATAGCTGCCCTGTACATATTCTACCAGCTACCTGGCATTGC
ATCGGCGCTGGCGTCTGGCGGCGCCTCGCTGGTCTATGGTTACACGACCGCACGCGATGCGCATGAAGGC
ATGCTGGCCAGAGCAGCCTCCCACACCGGCCGGATGATCGGTCGCGGTGCTCGGTTTGCCCGCCGCGCCT
TCGGATCAAGAAATGCCGGCGTATGA
 Primer design