SecReT4
Protein ID: 325168687
T4SS name [ID]VirB [189]
Gene symbol-
Locus tagAGROH133_14804
StrainAgrobacterium sp. H13-3
Repliconplasmid pAspH13-3a [GenBank: NC_015184] [Browse all T4SS(s) in this replicon]
Location [Strand]354464..354730 [+]
Producttype IV secretion protein AvhB7
Component typeVirB7
UniProt IDF0LGB7
KEGG IDagr:AGROH133_14804
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 88 a.a.     [Download]
>gi|325168687|ref|YP_004280477.1| unnamed protein product [Agrobacterium sp. H13-3]
MIKPALLIIFSATLVGCASMTYPLPNCDGYSRRPLNRSMWDWEGGSKLKQQQSNTSSSTSLTPFVKEASE
TSAFAHLDIDGSYRRCEG
 
Nucleotide Sequence: 267 bp     [Download]
>gi|325168279|ref|NC_015184.1|:354464-354730 Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence
ATGATTAAGCCTGCCCTGTTGATCATCTTTTCAGCCACGCTTGTCGGCTGCGCTTCGATGACCTACCCAT
TGCCGAACTGCGACGGCTATTCGCGACGCCCATTGAACCGCTCGATGTGGGACTGGGAGGGCGGCAGCAA
GCTGAAACAGCAGCAATCCAACACGAGTTCGTCCACGTCCCTCACACCTTTCGTTAAAGAGGCCAGCGAG
ACTTCCGCTTTTGCGCATCTGGACATCGACGGTTCCTATCGCCGCTGTGAGGGATGA
 Primer design