SecReT4
Protein ID: 325168688
T4SS name [ID]VirB [189]
Gene symbol-
Locus tagAGROH133_14805
StrainAgrobacterium sp. H13-3
Repliconplasmid pAspH13-3a [GenBank: NC_015184] [Browse all T4SS(s) in this replicon]
Location [Strand]354734..355405 [+]
Producttype IV secretion protein AvhB8
Component typeVirB8
UniProt IDF0LGB8
KEGG IDagr:AGROH133_14805
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1e-66, Aligned region: 13..220
Protein Sequence: 223 a.a.     [Download]
>gi|325168688|ref|YP_004280478.1| unnamed protein product [Agrobacterium sp. H13-3]
MVTTDNLKSYFDKARRFDQDRMIQVERSNRIAWSIAIVSGIVAAVAVFAVACLTPLKTVEPFVVRVDNST
GIVDVVSALTSTAGTYDEAVTKYFAAKYVRAREGYVWSEAQENFRTIALLSTQAEQTRFAALYRGSNPQS
PQNTYGRGATARIDIASISLINQNVVSVRYMRTITRGEEVRTTHWVASITYSYANAPMSSTDRLVNPLGF
VVSEYRADPEEVR
 
Nucleotide Sequence: 672 bp     [Download]
>gi|325168279|ref|NC_015184.1|:354734-355405 Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence
ATGGTGACGACAGATAATCTCAAGAGCTACTTCGACAAAGCACGTCGTTTCGACCAGGACCGGATGATCC
AGGTCGAGCGATCGAACAGGATTGCCTGGTCGATCGCCATAGTTTCAGGCATTGTCGCCGCTGTAGCCGT
CTTCGCGGTCGCGTGTCTCACACCCCTCAAGACGGTTGAACCCTTTGTGGTGCGCGTCGACAATTCGACC
GGCATTGTCGACGTCGTGTCAGCGCTGACATCGACGGCTGGCACCTACGATGAAGCGGTGACGAAATATT
TCGCTGCAAAATATGTCCGGGCCCGCGAGGGTTACGTCTGGAGTGAAGCACAGGAAAATTTCCGCACCAT
CGCCCTCTTGTCGACGCAAGCGGAGCAAACGCGTTTCGCGGCCCTCTACCGTGGCAGCAACCCGCAATCG
CCCCAGAATACTTATGGTCGCGGGGCTACAGCAAGGATCGATATCGCTTCAATCTCCCTCATCAATCAGA
ATGTCGTTTCCGTACGCTACATGCGAACCATCACGCGTGGCGAGGAAGTACGAACGACCCATTGGGTTGC
GTCGATCACCTATTCCTACGCGAACGCTCCGATGTCCTCCACGGACCGGCTCGTAAACCCGCTCGGCTTT
GTCGTCAGCGAGTATCGCGCTGATCCGGAGGAGGTGAGATGA
 Primer design