SecReT4
Protein ID: 325168689
T4SS name [ID]VirB [189]
Gene symbol-
Locus tagAGROH133_14807
StrainAgrobacterium sp. H13-3
Repliconplasmid pAspH13-3a [GenBank: NC_015184] [Browse all T4SS(s) in this replicon]
Location [Strand]355402..356256 [+]
Producttype IV secretion protein AvhB9
Component typeVirB9
UniProt IDF0LGB9
KEGG IDagr:AGROH133_14807
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.3e-59, Aligned region: 31..255
Protein Sequence: 284 a.a.     [Download]
>gi|325168689|ref|YP_004280479.1| unnamed protein product [Agrobacterium sp. H13-3]
MMRIPRIPALIVTLSMSPAFALEIPRGASQDSRVRFVNYQPYNITRVVGTLRSSVQVEFAADEEIAHVAL
GNSVAWEVAPAGNILFLKPRESQPVTNISVVTTRRDGSTRSYQMELTARDGSVEAGQNTYFYVKYRYPGD
DAELRRQQAASRALAAQAKDADNVLALHEAYGPRNWRYSSQGSQALEPQSVYDNGKITTFAFVGNQEMPA
IYMENSDGSESLVPKSVDGDLVMVHAISRKFILRRGKDVLCVFNEAYDRVGINPDTNTTSPSVERVVKRD
VTGQ
 
Nucleotide Sequence: 855 bp     [Download]
>gi|325168279|ref|NC_015184.1|:355402-356256 Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence
ATGATGCGCATCCCTCGAATTCCTGCACTCATCGTGACCCTTTCGATGTCGCCGGCGTTTGCGCTTGAGA
TACCCCGAGGTGCCTCGCAAGACAGTCGTGTCCGGTTCGTGAACTACCAACCCTACAACATCACGCGGGT
GGTCGGCACTCTGCGGTCATCCGTACAGGTCGAGTTCGCGGCGGACGAGGAAATCGCCCATGTCGCGCTC
GGCAACAGCGTCGCCTGGGAAGTTGCGCCGGCCGGCAACATCCTGTTCCTGAAGCCACGCGAGAGCCAGC
CGGTGACGAATATTTCCGTGGTTACGACGCGCAGGGATGGCTCGACCCGCAGCTACCAGATGGAACTGAC
GGCGCGCGATGGCTCCGTGGAGGCTGGTCAAAACACCTACTTCTACGTGAAGTACAGGTATCCAGGCGAT
GACGCCGAGCTTCGCCGCCAGCAGGCAGCGTCGAGGGCTCTCGCGGCCCAGGCGAAGGACGCCGACAATG
TGCTGGCGCTTCACGAAGCCTATGGCCCTCGAAACTGGCGCTATTCTTCTCAGGGATCGCAGGCACTGGA
GCCGCAAAGCGTCTACGACAACGGCAAGATTACAACGTTCGCCTTTGTGGGTAACCAGGAAATGCCCGCG
ATCTATATGGAGAACTCCGATGGCTCCGAAAGCCTTGTTCCGAAGTCGGTAGATGGAGATCTGGTGATGG
TGCACGCGATCAGCCGCAAGTTCATCCTGCGTCGGGGCAAGGATGTGCTCTGCGTCTTCAACGAAGCCTA
CGACCGCGTCGGTATCAATCCTGACACCAACACAACGTCTCCTTCGGTGGAGCGCGTCGTGAAGCGCGAC
GTTACCGGGCAATAG
 Primer design