SecReT4
Protein ID: 325168690
T4SS name [ID]VirB [189]
Gene symbol-
Locus tagAGROH133_14809
StrainAgrobacterium sp. H13-3
Repliconplasmid pAspH13-3a [GenBank: NC_015184] [Browse all T4SS(s) in this replicon]
Location [Strand]356271..357443 [+]
Producttype IV secretion protein AvhB10
Component typeVirB10
UniProt IDF0LGC0
KEGG IDagr:AGROH133_14809
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1e-60, Aligned region: 183..357
Protein Sequence: 390 a.a.     [Download]
>gi|325168690|ref|YP_004280480.1| unnamed protein product [Agrobacterium sp. H13-3]
MAQEDEDRIPGERAETVTSRQIDNSPLLKRGAVAIAIIAFVSFALWSTTGKKGRDENLQPERIIIRQTTP
FEAAKEKVEPDQALPEVKLPTPVVEPVIEEQDKLLDSARRAPVMAFSGGQRNRKELRESDSSYPSDNSNF
VPLDNNMSVQNQQNNEQQRFDGLLRPTRLEGSRAGTLGNRNFIVAMGTSIPCVLETALASDQPGFTTCVI
NRDVLSDNGRVVLMEKGTQVVGEYRGGLQRGQKRLFILWNRAKTPKGVVVTLASPATDALGRAGVDGHVD
THWWERFGSALLLSILGDATNYASSRLQDSDVDAQKTTSASQQAAAIAVEQSINIPPTLNKHQGEPVSIF
VARDLDFSGIYGLRVTEPRNRVFDRAVLGDFAPRSTLLTK
 
Nucleotide Sequence: 1173 bp     [Download]
>gi|325168279|ref|NC_015184.1|:356271-357443 Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence
ATGGCTCAGGAAGACGAGGATCGCATCCCCGGAGAGCGTGCCGAAACCGTCACCAGTCGTCAGATCGACA
ACAGCCCTCTCTTGAAACGCGGCGCTGTTGCCATTGCGATCATCGCGTTTGTCAGCTTCGCGCTTTGGTC
GACGACGGGAAAGAAGGGAAGGGATGAAAATCTTCAGCCCGAACGGATCATTATTCGTCAGACGACCCCC
TTCGAGGCCGCAAAAGAGAAAGTTGAACCGGACCAGGCGCTCCCTGAAGTAAAATTGCCAACGCCTGTCG
TCGAACCGGTCATTGAAGAGCAGGATAAGCTGCTCGATTCCGCCCGCCGCGCGCCCGTGATGGCCTTCAG
TGGAGGGCAGAGGAATCGGAAAGAGCTGAGGGAAAGCGACAGCTCTTATCCTTCCGACAACAGCAATTTC
GTGCCGCTCGACAACAATATGTCTGTTCAGAACCAGCAAAACAATGAGCAGCAGCGTTTCGATGGCCTGC
TGCGGCCAACGCGGCTTGAAGGCTCAAGGGCCGGTACACTCGGAAACCGCAATTTCATCGTCGCGATGGG
AACGTCCATTCCCTGCGTTCTTGAAACCGCGTTAGCATCCGACCAGCCGGGATTTACCACTTGTGTGATC
AACCGCGATGTTCTCTCTGACAATGGCAGGGTGGTCTTGATGGAAAAGGGCACGCAGGTTGTCGGCGAAT
ATCGTGGAGGGCTTCAACGCGGGCAAAAGCGCCTGTTCATTCTCTGGAATCGCGCGAAAACGCCGAAGGG
CGTTGTCGTCACTCTCGCATCACCAGCAACCGACGCACTTGGTCGTGCCGGTGTCGACGGCCATGTCGAC
ACCCATTGGTGGGAGCGGTTCGGCAGCGCTCTTCTGCTTTCCATTCTCGGGGACGCGACGAACTATGCAA
GCAGTCGGCTGCAGGACAGCGATGTCGACGCGCAAAAAACAACGAGTGCCAGTCAACAGGCGGCCGCCAT
CGCGGTCGAGCAGTCCATCAATATCCCGCCGACACTCAATAAGCACCAAGGTGAACCGGTTTCGATCTTT
GTCGCTCGCGATCTCGACTTTTCCGGCATCTACGGTCTTCGGGTGACCGAACCCAGAAACCGCGTTTTCG
ATCGTGCAGTCCTGGGGGATTTCGCGCCACGATCGACGCTCCTAACGAAATAG
 Primer design