SecReT4
Protein ID: 325168691
T4SS name [ID]VirB [189]
Gene symbol-
Locus tagAGROH133_14811
StrainAgrobacterium sp. H13-3
Repliconplasmid pAspH13-3a [GenBank: NC_015184] [Browse all T4SS(s) in this replicon]
Location [Strand]357452..358462 [+]
Producttype IV secretion protein AvhB11
Component typeVirB11
UniProt IDF0LGC1
KEGG IDagr:AGROH133_14811
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.4e-81, Aligned region: 15..317
Protein Sequence: 336 a.a.     [Download]
>gi|325168691|ref|YP_004280481.1| unnamed protein product [Agrobacterium sp. H13-3]
MAERQDSAVVSELMKPFSTFLQDKSLLEVIVNRPGQVLTEGPGGWRTYEMPELTFEKLMRLARAVASFSH
QSIDETRPILSATLPGNERIQIVIPPATINDTVSMTIRKPSSVDFSLDDLEEKGFFQTACAATSTSSSAQ
DEELCETYRAGRFKDFLRQAVIARKNIIISGATGSAKTTLSKALIKHIPENERVISIEDTPELVISQPNH
VRLFYSKGRQGLSRAGPKELLESCLRMRPDRILLQELRDGTAFYYIRNVNSGHPGSITTVHANSAELAFE
QLVLLVKESQGGAGLDRADIVAFLKASIDIVAQCRRHKGNFRLSEVYFRSECRATE
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|325168279|ref|NC_015184.1|:357452-358462 Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence
ATGGCAGAGAGGCAGGACTCGGCTGTCGTCAGCGAGCTGATGAAACCGTTTTCGACATTCCTTCAGGACA
AGTCTCTCCTAGAGGTGATCGTCAATCGGCCCGGGCAGGTCTTGACGGAAGGTCCTGGTGGGTGGCGGAC
CTATGAAATGCCGGAACTGACCTTCGAAAAGCTCATGCGTCTCGCCCGGGCAGTCGCAAGTTTTTCCCAT
CAGTCGATTGATGAGACGCGTCCAATATTGTCGGCGACGCTACCCGGGAACGAACGAATCCAGATCGTCA
TCCCCCCGGCGACCATCAATGACACTGTCAGCATGACAATCCGCAAGCCTTCCTCGGTCGACTTCAGTCT
TGATGATCTGGAGGAAAAGGGATTTTTCCAGACAGCGTGCGCAGCGACCAGTACCTCCTCCTCCGCGCAG
GATGAGGAACTGTGTGAAACATATCGTGCCGGCCGTTTTAAGGATTTCCTGCGGCAGGCCGTCATCGCTC
GAAAAAACATCATCATTTCTGGCGCCACAGGTTCGGCGAAAACGACACTTTCCAAAGCATTGATCAAGCA
TATTCCCGAAAACGAGAGGGTCATTTCAATCGAGGACACTCCCGAGCTCGTTATCTCACAACCGAACCAC
GTGCGCTTGTTCTACTCGAAAGGACGGCAGGGGCTTTCGCGTGCCGGACCGAAAGAGCTTCTCGAATCCT
GTCTTCGTATGCGGCCGGATAGGATTCTGCTTCAGGAGCTTCGCGATGGGACGGCCTTTTATTATATCCG
GAACGTGAATTCGGGCCATCCTGGCTCAATAACCACGGTCCATGCGAACTCGGCCGAATTGGCTTTTGAG
CAACTGGTCCTGCTCGTTAAGGAGTCGCAGGGCGGCGCAGGCCTGGACCGGGCCGACATCGTGGCTTTTT
TGAAGGCGAGTATCGATATCGTTGCTCAGTGCAGGCGACACAAAGGAAACTTTCGGCTGTCTGAGGTGTA
TTTCAGGAGTGAGTGTAGAGCCACGGAATAG
 Primer design