SecReT4
Protein ID: 325168975
T4SS name [ID]VirB [21]
Gene symboltraG
Locus tagACMV_P2_00440
StrainAcidiphilium multivorum AIU301
Repliconplasmid pACMV2 [GenBank: NC_015187] [Browse all T4SS(s) in this replicon]
Location [Strand]42971..45007 [-]
Productconjugal transfer protein TraG
Component typeVirD4
UniProt IDF0J7Q7
KEGG IDamv:ACMV_P2_00440
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3e-79, Aligned region: 205..675
MobA_MobL [PF03389], Evalue: 2.8e-41, Aligned region: 17..162
TraG-D_C [PF12696], Evalue: 4e-24, Aligned region: 503..630
TrwB_AAD_bind [PF10412], Evalue: 4e-14, Aligned region: 251..639
Protein Sequence: 678 a.a.     [Download]
>gi|325168975|ref|YP_004285722.1| conjugal transfer protein TraG [Acidiphilium multivorum AIU301]
MAIYRCEIKNISRGQGRSCVAAAAYRHRTSLHDQRQELDHAYTHKGDVELSEIVAPENAPEWVHDRERLW
NAADAAEKRKDARTAKEVLVALPRELNTAEQAGLVREFARAEFASKGLVADIAIHAPKAQDGETQPHAHI
MLTTRPLENGSFAKGKDYSLDKPPGIEAIRDAPIRAPTDNHGHARWMTMEEARARFPGPTPEYGGLVVGE
AYEVHRDSVASMPFRPKDRASWGQGGKAPLLIDPCEIGSTHCMMFAGSGGYKTTTAISTLLTWTGSAIVL
DPSVELGPMLRQAREAMGHKVYMLDPRTAREVGFNVLDWIDVSSLLAEIDVQAVVEWVCGDTKQGGDENA
SFFKNSGKELVTALLAHMLWDERLEPHEKTLRAVRAAIVTPEKELRNILAHIHKNSQSRLARDLAGSLKD
IVDETFSGIYKNATQDTAWLSTAAYADLVSGNTFRCAELTLGKATVFINIPLKALDATPAVARVITGALL
NAAYEADGAIEGRVLFLLDEAARLGPMKILETARDCARKYKITLFPFYQSIGQLRELFGQDGPAKWFESV
SWYGFAGVKTKAVAEELAAAIGEYGVLAWSEGSNTGNSAKGLEAGTRSTGQTKTYHELKRQLIRAEEIMH
DMRDDEQIIFPKSGRPLRCGRAIYFRRPEMAVRVGENRFAGKAIKAAE
 
Nucleotide Sequence: 2037 bp     [Download]
>gi|325168931|ref|NC_015187.1|:c45007-42971 Acidiphilium multivorum AIU301 plasmid pACMV2, complete sequence
GTGGCAATCTATCGTTGCGAGATCAAGAATATCAGCCGGGGTCAGGGTCGATCCTGCGTCGCCGCTGCCG
CCTATCGGCATCGCACCAGCCTGCACGACCAGCGCCAGGAACTGGATCATGCCTACACCCACAAGGGCGA
CGTCGAACTCTCCGAGATCGTCGCACCAGAGAACGCGCCCGAATGGGTCCACGATCGCGAACGCCTGTGG
AATGCCGCCGATGCCGCCGAGAAGCGCAAGGATGCCCGCACCGCCAAGGAAGTCCTGGTCGCCCTCCCGC
GCGAACTGAACACCGCCGAACAGGCCGGTCTGGTCCGCGAGTTCGCCCGCGCCGAGTTCGCCAGCAAGGG
CCTCGTCGCCGATATCGCCATCCACGCCCCCAAGGCACAGGACGGCGAGACGCAACCTCACGCCCACATC
ATGCTCACCACCCGCCCCCTGGAGAACGGCAGCTTCGCCAAGGGCAAGGACTACAGCCTCGACAAGCCCC
CCGGCATCGAGGCCATCCGCGATGCGCCGATCCGTGCCCCAACCGACAACCACGGGCATGCCCGCTGGAT
GACGATGGAGGAGGCCCGCGCCCGGTTTCCGGGGCCTACCCCGGAATATGGCGGGCTTGTCGTGGGCGAG
GCTTACGAGGTTCACCGCGATAGCGTTGCCAGCATGCCGTTCCGGCCGAAGGATCGTGCAAGCTGGGGGC
AGGGGGGCAAGGCACCTCTGCTTATCGATCCATGCGAGATTGGCTCAACACATTGCATGATGTTCGCCGG
ATCGGGCGGCTATAAGACGACAACGGCCATTTCCACACTGCTGACATGGACAGGCTCGGCCATTGTCCTT
GACCCCTCGGTGGAGCTGGGGCCGATGCTGCGCCAGGCGCGCGAGGCCATGGGCCACAAGGTCTATATGC
TTGATCCCCGCACGGCCCGCGAAGTCGGGTTTAACGTGCTGGACTGGATCGATGTATCCTCCCTGCTCGC
GGAAATCGACGTGCAGGCCGTGGTTGAGTGGGTTTGCGGCGATACCAAGCAAGGCGGCGATGAGAACGCC
TCCTTCTTCAAGAACAGCGGCAAGGAGCTGGTGACGGCGCTGCTCGCGCACATGCTCTGGGATGAACGCC
TGGAACCGCACGAAAAGACCTTGCGCGCTGTCCGCGCGGCCATCGTCACCCCTGAAAAAGAGCTGCGGAA
CATCCTGGCCCATATTCACAAGAACTCGCAAAGCCGTCTGGCCCGTGACCTGGCCGGGAGCTTGAAGGAC
ATTGTGGATGAGACCTTTAGCGGCATCTACAAAAACGCCACCCAAGACACGGCTTGGCTTTCCACCGCCG
CTTATGCGGATCTCGTCTCCGGCAACACGTTCCGGTGCGCTGAGCTGACGCTCGGCAAGGCCACGGTTTT
CATCAACATTCCGCTCAAGGCGCTCGATGCTACACCGGCCGTCGCCCGCGTCATCACGGGCGCCCTGCTG
AACGCGGCTTACGAAGCGGATGGCGCGATCGAAGGCCGCGTGTTGTTCCTGCTCGATGAGGCCGCCCGCC
TCGGCCCCATGAAAATCCTCGAAACCGCCCGCGACTGTGCCCGGAAATACAAGATTACGCTGTTTCCGTT
CTATCAGTCGATCGGCCAGCTTCGCGAGCTGTTCGGCCAGGACGGCCCGGCCAAGTGGTTTGAATCAGTC
AGCTGGTATGGCTTCGCCGGCGTCAAAACTAAGGCCGTCGCCGAGGAGCTGGCTGCGGCGATCGGTGAAT
ATGGCGTGCTGGCCTGGTCGGAAGGCTCGAACACCGGCAACTCGGCAAAGGGCCTGGAAGCGGGCACGCG
CTCGACCGGCCAGACCAAAACCTATCATGAGCTGAAACGCCAACTCATCCGCGCCGAGGAAATCATGCAC
GACATGCGGGACGATGAGCAGATCATCTTCCCGAAATCCGGCCGGCCGCTGCGCTGCGGCCGGGCCATTT
ATTTCCGGCGGCCTGAGATGGCCGTCCGTGTGGGCGAGAATCGGTTTGCTGGCAAGGCCATCAAAGCGGC
TGAATAG
 Primer design