SecReT4
Protein ID: 325168986
T4SS name [ID]VirB [21]
Gene symbolvirB11
Locus tagACMV_P2_00550
StrainAcidiphilium multivorum AIU301
Repliconplasmid pACMV2 [GenBank: NC_015187] [Browse all T4SS(s) in this replicon]
Location [Strand]54216..55283 [-]
Producttype IV secretion system VirB11
Component typeVirB11
UniProt IDF0J7R8
KEGG IDamv:ACMV_P2_00550
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.5e-58, Aligned region: 25..321
Protein Sequence: 355 a.a.     [Download]
>gi|325168986|ref|YP_004285733.1| type IV secretion system VirB11 [Acidiphilium multivorum AIU301]
MNDTEFSDDLVAESPAAPLLRFLLAPLQPWLNDGATEELCINRPGECWVRQRGVFERYKMPLDRSALEDI
AVLAGALRRQDVGPTSPLCSTELPGGERLQVCLPPAVPTGTVSLTIRRPGSTVAPLSSVTSRYQSEGWNT
WAQNRETRNFAEALEYYDSGDLEGFLAAAVRCRMTILLCGATGSGKTTMSKTLISAIPMAERIITIEDTA
ELVIPQPNHVRLLYSKDGLSTAKIDAEALLQASLRMRPNRVLLQELRDDAAWTYVNEVVSGHPGSITTIH
GANPAQAFKKLFSLIKGSPKGAGFDDATLCDLLAAAVDLIIPFETSGSTYRIGKVWFGPDAARRGETAAA
LLRAA
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|325168931|ref|NC_015187.1|:c55283-54216 Acidiphilium multivorum AIU301 plasmid pACMV2, complete sequence
ATGAACGACACCGAATTTTCCGATGATCTCGTTGCGGAAAGCCCGGCCGCGCCTCTGCTCCGCTTCCTGC
TCGCCCCGCTGCAACCCTGGCTGAACGATGGGGCGACTGAGGAGCTGTGCATCAACAGGCCGGGCGAGTG
CTGGGTGCGCCAGCGCGGCGTTTTCGAGCGATACAAGATGCCGCTCGATCGCTCGGCGCTGGAAGATATT
GCCGTGCTCGCCGGCGCGCTGCGCCGTCAGGATGTTGGCCCCACGTCGCCGCTTTGTTCCACCGAACTGC
CAGGCGGCGAACGGCTGCAAGTCTGTCTGCCGCCGGCCGTGCCAACGGGCACGGTCAGTCTGACGATCCG
CCGGCCCGGCTCGACGGTGGCGCCGCTGTCGTCCGTCACCTCCCGGTATCAGTCGGAAGGGTGGAACACC
TGGGCACAAAACCGGGAAACCCGGAATTTTGCGGAAGCCCTGGAATACTACGATTCCGGCGATCTTGAGG
GCTTCCTTGCGGCGGCCGTACGCTGCCGCATGACCATCCTGCTCTGTGGTGCCACCGGCTCCGGCAAAAC
CACGATGAGCAAAACGCTGATCTCGGCGATCCCCATGGCGGAGCGGATCATCACGATCGAGGACACGGCG
GAGCTGGTGATCCCGCAGCCGAATCATGTCCGGCTGCTCTACTCGAAAGACGGCCTCTCCACCGCGAAAA
TCGACGCCGAAGCGCTGTTGCAGGCCAGCCTTCGCATGCGGCCGAACCGGGTGCTCCTGCAAGAGCTGCG
CGACGATGCGGCATGGACCTATGTAAACGAGGTGGTTTCCGGGCATCCGGGCTCGATCACAACCATTCAC
GGGGCCAATCCGGCCCAGGCGTTCAAGAAGCTGTTTTCGCTCATCAAGGGCTCCCCCAAGGGTGCTGGCT
TTGATGACGCCACGCTTTGCGATCTGCTCGCGGCGGCTGTCGATCTCATCATCCCCTTCGAGACTTCCGG
CAGCACCTACCGGATCGGCAAGGTCTGGTTTGGCCCTGACGCGGCCAGGCGCGGTGAAACAGCCGCCGCC
CTCTTGCGGGCCGCCTGA
 Primer design