SecReT4
Protein ID: 325168988
T4SS name [ID]VirB [21]
Gene symbolvirB10
Locus tagACMV_P2_00570
StrainAcidiphilium multivorum AIU301
Repliconplasmid pACMV2 [GenBank: NC_015187] [Browse all T4SS(s) in this replicon]
Location [Strand]55597..56733 [-]
Producttype IV secretion system VirB10
Component typeVirB10
UniProt IDF0J7S0
KEGG IDamv:ACMV_P2_00570
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.7e-57, Aligned region: 191..367
Protein Sequence: 378 a.a.     [Download]
>gi|325168988|ref|YP_004285735.1| type IV secretion system VirB10 [Acidiphilium multivorum AIU301]
MANEDKRDRPYGPISHDNAAPSPVEQEQSAVASRQRLTGRQIGGIALACALGAGVVLVVTQLTTHHEPKP
AKQAAVTGGTEGRPFVNNASGGTAPASKPAALPLPSKQNTGFHNPFLNNQQESPAMKALKAPIMAFNQTG
GGVSAQPASNTVGQNGAPTAGPVKPTAFASKLNADQFSAADATMIAHPNFTIAAGTIIPCTLQTAINSTL
PGFVKCVLPQPVRSMNGTVTLLDKGTQVLGEVREGLVQGQDRLFILWDRAVTPQNVAIQLASPAADPLGR
AGVSGAVNNHFLERFGAAIMMTIIGGSMQVAANAAQNSAGNTYLEYMNSSTNQIANTTLQHTIDIPPTLT
KHQGENVSIFVARDLNFSKVYKLSVVSP
 
Nucleotide Sequence: 1137 bp     [Download]
>gi|325168931|ref|NC_015187.1|:c56733-55597 Acidiphilium multivorum AIU301 plasmid pACMV2, complete sequence
ATGGCAAATGAGGACAAGCGGGACCGCCCTTATGGGCCGATAAGCCACGACAACGCAGCGCCGTCGCCGG
TCGAACAGGAACAATCGGCGGTTGCCAGCCGGCAGCGCCTGACCGGGCGCCAAATCGGCGGCATTGCCCT
GGCCTGCGCCCTCGGCGCTGGCGTCGTGCTCGTGGTAACGCAGCTCACCACCCATCATGAGCCAAAGCCT
GCCAAACAGGCCGCCGTGACCGGCGGGACCGAAGGCCGGCCCTTCGTCAATAATGCGAGCGGCGGCACGG
CGCCTGCCTCCAAACCTGCCGCGCTGCCCCTGCCGTCCAAGCAGAACACGGGGTTTCACAATCCGTTCCT
GAACAATCAGCAGGAATCCCCTGCCATGAAGGCGCTCAAGGCACCGATCATGGCGTTCAACCAAACTGGC
GGTGGAGTATCCGCGCAACCTGCCAGCAATACCGTGGGCCAGAACGGCGCTCCCACCGCTGGGCCTGTGA
AACCCACGGCCTTCGCGAGCAAGCTCAACGCGGATCAGTTCAGCGCGGCCGATGCCACGATGATCGCGCA
TCCGAATTTCACGATCGCGGCCGGCACCATCATTCCCTGCACGCTGCAAACCGCGATCAACTCGACCCTG
CCGGGCTTCGTCAAATGCGTATTACCGCAGCCCGTGCGCTCGATGAACGGCACGGTGACGTTGCTGGACA
AGGGAACGCAAGTTCTGGGCGAGGTTCGCGAGGGCCTGGTGCAAGGCCAGGATCGGCTTTTCATCCTCTG
GGACCGCGCGGTGACGCCGCAGAATGTCGCCATTCAGCTCGCCTCGCCGGCAGCCGATCCCCTCGGCCGG
GCTGGCGTCTCGGGTGCGGTCAACAACCATTTCCTCGAACGGTTCGGCGCGGCGATCATGATGACGATCA
TCGGCGGCTCGATGCAGGTGGCGGCAAACGCCGCCCAGAACAGCGCCGGCAACACGTATCTGGAATATAT
GAACTCAAGCACAAACCAGATCGCCAACACCACGCTGCAACACACGATCGACATTCCGCCCACGCTGACC
AAGCACCAGGGCGAGAATGTCTCGATCTTCGTGGCCCGCGATCTGAATTTCTCCAAGGTCTATAAGCTGT
CGGTTGTCTCGCCATGA
 Primer design