SecReT4
Protein ID: 325168989
T4SS name [ID]VirB [21]
Gene symbolvirB9
Locus tagACMV_P2_00580
StrainAcidiphilium multivorum AIU301
Repliconplasmid pACMV2 [GenBank: NC_015187] [Browse all T4SS(s) in this replicon]
Location [Strand]56723..57613 [-]
Producttype IV secretion system VirB9
Component typeVirB9
UniProt IDF0J7S1
KEGG IDamv:ACMV_P2_00580
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 7.3e-51, Aligned region: 33..266
Protein Sequence: 296 a.a.     [Download]
>gi|325168989|ref|YP_004285736.1| type IV secretion system VirB9 [Acidiphilium multivorum AIU301]
MKCSRKLATGGLIWLGMMGTAFAVQYPQPGHEDARVRYVPYQSGNVTDIWTAPGAALTVQFGTGEKVVSV
AESDSAYLKVVPVQNYLFIKPTGILPAQPIAVLCKTADGKLRHYFFQFETVNKQLGAGENVDYAVVFTYP
HQAYERQLAKRKAAEAKAVQQEAKNRLDEARAVMNAATVDRYQGPRNYEYVARGDHQLAPAEVWDNGYST
VFTFPAMQRIPAIFYVQPDGKEATANYSVNGDTVVVPGTAPEWRLRDGHTVLDIYDLKYNPTGATPGTHT
ISPDVAREMRTFNDGK
 
Nucleotide Sequence: 891 bp     [Download]
>gi|325168931|ref|NC_015187.1|:c57613-56723 Acidiphilium multivorum AIU301 plasmid pACMV2, complete sequence
ATGAAGTGCTCGCGCAAACTCGCGACTGGCGGGCTCATTTGGCTCGGCATGATGGGGACGGCCTTTGCTG
TGCAGTATCCTCAGCCGGGGCATGAAGATGCCCGCGTTCGCTACGTGCCCTATCAGTCAGGCAACGTCAC
TGACATCTGGACCGCGCCGGGTGCGGCGCTGACGGTCCAGTTTGGAACGGGAGAAAAGGTCGTCTCAGTC
GCGGAGAGCGATAGCGCCTATCTCAAGGTCGTCCCGGTCCAGAATTACCTTTTCATCAAGCCAACTGGCA
TTCTGCCGGCACAGCCGATCGCGGTTCTTTGCAAAACGGCAGACGGTAAGCTCCGGCATTATTTCTTCCA
GTTTGAGACCGTGAACAAGCAGCTCGGCGCCGGCGAGAATGTCGATTACGCCGTGGTGTTCACCTATCCG
CACCAGGCTTATGAGCGCCAGCTCGCCAAGCGAAAGGCGGCCGAGGCGAAGGCCGTCCAGCAGGAAGCCA
AAAACCGGCTTGATGAAGCGCGCGCGGTCATGAACGCGGCAACGGTCGATCGATACCAGGGGCCACGCAA
TTACGAGTATGTCGCCCGTGGCGATCATCAACTCGCCCCCGCCGAGGTCTGGGACAACGGCTATTCAACC
GTGTTCACCTTCCCGGCCATGCAGCGCATCCCGGCCATTTTCTATGTTCAGCCGGACGGCAAGGAAGCAA
CTGCCAATTATTCGGTCAACGGGGATACGGTCGTTGTGCCGGGCACCGCGCCAGAATGGCGGCTGCGCGA
CGGGCATACGGTCCTCGATATTTACGATCTCAAATACAACCCGACCGGCGCCACGCCAGGCACACACACG
ATCAGCCCGGATGTCGCGCGCGAGATGAGGACGTTCAACGATGGCAAATGA
 Primer design