SecReT4
Protein ID: 325168990
T4SS name [ID]VirB [21]
Gene symbolvirB8
Locus tagACMV_P2_00590
StrainAcidiphilium multivorum AIU301
Repliconplasmid pACMV2 [GenBank: NC_015187] [Browse all T4SS(s) in this replicon]
Location [Strand]57610..58311 [-]
Producttype IV secretion system VirB8
Component typeVirB8
UniProt IDF0J7S2
KEGG IDamv:ACMV_P2_00590
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.7e-50, Aligned region: 24..228
Protein Sequence: 233 a.a.     [Download]
>gi|325168990|ref|YP_004285737.1| type IV secretion system VirB8 [Acidiphilium multivorum AIU301]
MNADMKSTALPIDNERLASYFQDVESFQASEKRTARRWGRVGWVVAGVSLAVNVTLAGAIVMILPLEKLV
PAFITVKSDGTTSTTMNFNSLPSNEKAAMTRAAIWQYVRARESYDFADAQYRYDVASLMSNPTVQSTYQS
WFLDKGPGSTSPQVTVGKKGQISVEMVSLSMVRPNVALVRFRRTVTMYGSDPQTSTWTATVGFENVATLP
VSARLADPSGLIVTNYQALKDSP
 
Nucleotide Sequence: 702 bp     [Download]
>gi|325168931|ref|NC_015187.1|:c58311-57610 Acidiphilium multivorum AIU301 plasmid pACMV2, complete sequence
ATGAATGCGGACATGAAAAGCACGGCGCTGCCGATCGATAACGAACGGCTGGCCTCCTATTTCCAAGATG
TTGAATCTTTCCAAGCCTCGGAAAAGCGCACCGCCCGCCGCTGGGGCCGTGTGGGCTGGGTGGTGGCCGG
CGTGTCCCTGGCGGTCAACGTCACACTGGCCGGGGCGATCGTGATGATCCTGCCGCTCGAAAAGCTCGTG
CCTGCGTTCATCACGGTAAAATCTGACGGCACCACCAGCACCACGATGAATTTCAACAGCCTTCCCAGCA
ATGAGAAGGCGGCGATGACCAGGGCGGCGATCTGGCAATATGTCCGTGCGCGCGAAAGCTATGACTTCGC
CGACGCGCAATATCGCTATGATGTTGCCTCTCTTATGTCGAACCCCACGGTGCAAAGCACCTATCAAAGC
TGGTTCCTCGACAAAGGGCCTGGCAGCACCAGCCCGCAGGTGACGGTCGGCAAAAAGGGGCAAATCAGCG
TCGAGATGGTGAGCCTGTCCATGGTGCGGCCGAACGTCGCACTCGTGCGCTTCCGCCGTACCGTGACGAT
GTACGGCTCTGATCCGCAGACTTCGACATGGACCGCGACGGTCGGTTTTGAAAATGTCGCAACGCTGCCG
GTTTCCGCCCGCCTTGCTGATCCCAGCGGGCTCATTGTGACCAACTACCAAGCCCTAAAGGATTCGCCAT
GA
 Primer design