SecReT4
Protein ID: 325168991
T4SS name [ID]VirB [21]
Gene symbol-
Locus tagACMV_P2_00600
StrainAcidiphilium multivorum AIU301
Repliconplasmid pACMV2 [GenBank: NC_015187] [Browse all T4SS(s) in this replicon]
Location [Strand]58308..58490 [-]
Producthypothetical protein
Component typeVirB7
UniProt IDF0J7S3
KEGG IDamv:ACMV_P2_00600
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 60 a.a.     [Download]
>gi|325168991|ref|YP_004285738.1| hypothetical protein ACMV_P2_00600 [Acidiphilium multivorum AIU301]
MKGSRMLSRLIILMCAAGLLAGCAASDPLAKAHGPMFALNPGHWSPSSAQLAQPPQVPRT
 
Nucleotide Sequence: 183 bp     [Download]
>gi|325168931|ref|NC_015187.1|:c58490-58308 Acidiphilium multivorum AIU301 plasmid pACMV2, complete sequence
ATGAAGGGCTCCCGCATGTTGTCTCGACTGATCATCCTCATGTGCGCGGCCGGCCTGCTGGCGGGCTGCG
CCGCCAGTGACCCGCTGGCAAAGGCTCACGGGCCGATGTTCGCCCTCAATCCCGGTCATTGGTCGCCAAG
TTCAGCGCAGTTGGCGCAACCGCCGCAGGTGCCGCGCACATGA
 Primer design