SecReT4
Protein ID: 325168992
T4SS name [ID]VirB [21]
Gene symbolvirB6
Locus tagACMV_P2_00610
StrainAcidiphilium multivorum AIU301
Repliconplasmid pACMV2 [GenBank: NC_015187] [Browse all T4SS(s) in this replicon]
Location [Strand]58490..59377 [-]
Producttype IV secretion system VirB6
Component typeVirB6
UniProt IDF0J7S4
KEGG IDamv:ACMV_P2_00610
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.1e-43, Aligned region: 45..276
Protein Sequence: 295 a.a.     [Download]
>gi|325168992|ref|YP_004285739.1| type IV secretion system VirB6 [Acidiphilium multivorum AIU301]
MSVPNTTINIFEFMYSQYSTGFLQSLNSDVGSALSAALPPLSAALVIWVIILGYLMMTGSLDIRYGISKV
STMAIVVGIIASTSLYDSYVQTLFMKSLPSFIASTFSSGNTSNIPQSLDQTFNNFWVAGQIIYKKANCAT
CVLEPYVLGIEIELVLVVFFIALALVFAVYLIATTLTGLLVAIGPFLLIGYLFEATKGIPERWLGKLIGL
AILLLLITALLSLFTGGMTDFLNTKVSTTFVADPVQTEIIILGEIAAYTAITAFITIMLPGIAAYIGGGV
DFNISGIVNPANWFK
 
Nucleotide Sequence: 888 bp     [Download]
>gi|325168931|ref|NC_015187.1|:c59377-58490 Acidiphilium multivorum AIU301 plasmid pACMV2, complete sequence
ATGAGCGTCCCCAACACGACCATCAACATCTTTGAGTTTATGTATAGCCAATACAGCACGGGATTCTTGC
AATCGCTGAATAGCGATGTCGGCTCCGCGTTGTCGGCGGCTTTACCGCCTCTCTCCGCTGCCCTGGTCAT
CTGGGTCATCATCCTCGGCTACCTCATGATGACCGGCAGCCTGGACATACGTTACGGCATCTCAAAGGTT
TCAACGATGGCGATCGTGGTGGGCATTATCGCTTCTACGTCGCTTTATGATTCCTACGTCCAGACTCTTT
TTATGAAGTCTCTGCCTAGCTTCATCGCCAGCACTTTTTCGTCTGGGAATACGAGCAACATCCCGCAAAG
CCTTGATCAGACCTTCAATAATTTTTGGGTTGCCGGACAAATCATCTACAAAAAGGCAAACTGCGCGACC
TGCGTGCTCGAACCATATGTCCTTGGCATCGAAATCGAGCTGGTTCTTGTCGTCTTTTTCATCGCTCTTG
CCCTTGTGTTCGCGGTGTATCTCATCGCGACAACACTGACGGGTCTCCTCGTCGCCATCGGGCCATTCCT
GCTGATCGGATACCTCTTTGAAGCGACGAAGGGTATTCCCGAACGCTGGCTCGGCAAGCTGATCGGCCTC
GCGATCCTGTTGCTCCTGATCACGGCGCTTCTATCGCTGTTCACCGGCGGCATGACTGATTTTCTGAACA
CCAAGGTCTCGACAACTTTCGTCGCTGACCCTGTGCAGACTGAAATCATCATCCTCGGCGAAATCGCCGC
CTATACCGCCATCACGGCCTTCATCACGATCATGCTCCCTGGCATTGCCGCCTACATTGGCGGCGGTGTG
GACTTCAATATTTCCGGGATCGTGAACCCGGCCAACTGGTTCAAATAA
 Primer design