SecReT4
Protein ID: 325168994
T4SS name [ID]VirB [21]
Gene symbolvirB5
Locus tagACMV_P2_00630
StrainAcidiphilium multivorum AIU301
Repliconplasmid pACMV2 [GenBank: NC_015187] [Browse all T4SS(s) in this replicon]
Location [Strand]59607..60365 [-]
Producttype IV secretion system VirB5
Component typeVirB5
UniProt IDF0J7S6
KEGG IDamv:ACMV_P2_00630
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 2.6e-31, Aligned region: 26..222
Protein Sequence: 252 a.a.     [Download]
>gi|325168994|ref|YP_004285741.1| type IV secretion system VirB5 [Acidiphilium multivorum AIU301]
MLKPARLLGIAFAIATLGFASPALAQVPVIDSASLAQLISQLNEAKQQYSELVSQYDELKSTYNALSQDV
NPNQWAQQLDQSAMQDTVPNTSILPDMLDGISPPSSLSGNVGSLAQQYYNMNKVYIPTGSDFGSTQMQQG
ANETANFEAIATQNLQSLEAREQELPQIQSQLNSAKTIQQVASIQARLSAEQNYVQAQQAQAQNLQLLAF
EENRAGQEAAAQENAQGGEQTLSTLCSDAQTLGGEPSACQGQ
 
Nucleotide Sequence: 759 bp     [Download]
>gi|325168931|ref|NC_015187.1|:c60365-59607 Acidiphilium multivorum AIU301 plasmid pACMV2, complete sequence
ATGCTCAAGCCCGCACGCCTGCTCGGAATTGCTTTCGCTATCGCCACACTCGGCTTTGCCTCACCCGCCT
TGGCGCAAGTGCCGGTGATCGATAGCGCTTCCCTCGCCCAGCTCATCAGCCAGCTCAACGAGGCAAAACA
GCAATATTCCGAGCTGGTCAGCCAATATGATGAGCTAAAATCGACCTACAACGCGCTCTCGCAGGACGTG
AACCCGAACCAATGGGCGCAACAGCTCGATCAATCGGCCATGCAGGACACGGTGCCCAACACCAGCATCT
TGCCGGACATGCTCGACGGTATCAGCCCGCCCTCCTCGCTGAGCGGCAATGTCGGTTCTCTCGCGCAACA
ATATTACAACATGAACAAGGTCTATATCCCGACCGGCTCGGATTTCGGCTCGACGCAAATGCAGCAAGGC
GCCAACGAGACCGCGAATTTCGAGGCGATAGCCACGCAGAACCTGCAATCTCTGGAAGCTCGCGAGCAAG
AGCTGCCGCAGATTCAGAGCCAGCTTAACAGCGCCAAGACGATCCAGCAGGTCGCCTCAATTCAGGCCCG
CCTCTCCGCCGAACAGAACTATGTGCAGGCCCAGCAAGCCCAGGCGCAAAACCTGCAACTATTGGCGTTC
GAGGAGAACCGCGCCGGTCAGGAGGCCGCCGCCCAAGAAAACGCACAAGGCGGAGAACAAACGCTCTCGA
CGCTGTGCAGCGACGCTCAAACTCTCGGCGGGGAGCCATCGGCATGTCAGGGACAATGA
 Primer design