SecReT4
Protein ID: 325168995
T4SS name [ID]VirB [21]
Gene symbolvirB4
Locus tagACMV_P2_00640
StrainAcidiphilium multivorum AIU301
Repliconplasmid pACMV2 [GenBank: NC_015187] [Browse all T4SS(s) in this replicon]
Location [Strand]60375..62768 [-]
Producttype IV secretion system VirB4
Component typeVirB4
UniProt IDF0J7S7
KEGG IDamv:ACMV_P2_00640
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.6e-42, Aligned region: 190..383
AAA_10 [PF12846], Evalue: 4.6e-26, Aligned region: 437..717
Protein Sequence: 797 a.a.     [Download]
>gi|325168995|ref|YP_004285742.1| type IV secretion system VirB4 [Acidiphilium multivorum AIU301]
MPGNQIRAERSAERYLPYLGHVRPDILLMDDGSVLAMAEIPGAPYELAADADRAASLVTVNALCKNVADD
NVTLHSAFVRGPGAGQLAHALMPNEFAASLDRAYRERVLTGRLYQNTWYLTVIVSPRNPLGGKAGGATGS
LFGGKRERQKPHATAEGIRQLEEIWQTISQTLAPYDVRRLGLRPAANGQFYFSEIAEALRLILTGTAAPV
PLVSGPLGAALYTDRAIFGRRAFELRGPGVSRFGAIFGYREYPSETYAGMYDGVFSLPCPVVMVHTFDFH
ARHTSEKRLGLKSAQMTAANDKAKSQINDLADAQDHLASGKIAMGEHHFSLTVYADTIEELDRLSGLTRT
VIANSGGVVAQESAGLEAAYFAQLPGNRKWRTRPGTITTRNFAAFSGFEAFPRGQRAGKWGPAMARFRTT
AGTAYDYVPHVEDVGMTAIFGKIGQGKTTFMLFLLALFPQYFAARNGAVVFFDKDRGGELLCRAVGGRYL
VVRAGRDSGLAPLKALDNTPESVAFLVQWLTALIQQDGHGPLPPEDDARLTRGVQALLRLAPEMRSLAGL
RQFLDWRNPMGAGARLERWCKGGSLGWAFDGEHDDVSLDATTVGFDLTAILDNGTVCAPAANYLLYRISQ
ALDGRRFVLSCDEFNFYLLNPLFAKIWADFMLTVRKSNAVVLLATQEPAPVLDSPQGDSILRQCQTLVFC
PTPGAEENLYRKRLNFTAGEFRAIAEDMLPNSRQLLIKRHGGSAIIDFDLSALPEFVAILSSRKSSVGFV
ERLRATHGDDPTAWLPEFMARFREEVE
 
Nucleotide Sequence: 2394 bp     [Download]
>gi|325168931|ref|NC_015187.1|:c62768-60375 Acidiphilium multivorum AIU301 plasmid pACMV2, complete sequence
ATGCCGGGTAATCAAATCAGGGCGGAACGCAGCGCCGAACGCTATTTGCCGTATCTCGGACATGTTCGGC
CGGACATCCTGCTCATGGATGACGGCAGCGTTCTCGCCATGGCCGAAATCCCCGGCGCTCCCTATGAGCT
GGCGGCCGATGCGGATCGCGCCGCGAGCCTGGTCACGGTCAATGCGCTCTGCAAAAACGTCGCGGATGAC
AACGTGACGCTGCATTCGGCTTTCGTGCGAGGGCCGGGGGCCGGGCAGCTCGCGCACGCGCTCATGCCCA
ACGAGTTCGCTGCCTCCCTCGATCGCGCCTATCGCGAGCGCGTCCTCACGGGCCGCCTCTACCAAAACAC
TTGGTATCTGACGGTGATTGTCTCCCCCCGCAATCCGCTGGGCGGCAAGGCGGGCGGCGCCACGGGCTCC
TTGTTCGGTGGCAAACGGGAGCGCCAGAAGCCCCACGCAACCGCCGAAGGCATCCGCCAGCTAGAGGAGA
TTTGGCAAACCATCAGCCAAACCCTCGCCCCTTATGATGTCCGCCGGCTGGGCCTGCGGCCTGCCGCCAA
TGGCCAGTTCTATTTCAGTGAAATCGCCGAGGCGCTGCGCCTGATCCTGACGGGCACGGCGGCGCCGGTG
CCCCTGGTCAGCGGCCCGCTCGGTGCCGCCCTCTATACCGATCGCGCGATCTTCGGCCGCCGCGCCTTTG
AGCTGCGCGGGCCGGGCGTTTCCCGGTTCGGGGCGATCTTCGGCTATCGCGAGTATCCGTCCGAAACCTA
TGCCGGCATGTATGATGGGGTCTTTTCCCTGCCGTGCCCGGTGGTGATGGTCCACACCTTCGACTTTCAC
GCACGGCATACCTCTGAAAAGCGGCTCGGCCTGAAATCGGCTCAGATGACGGCCGCGAACGACAAAGCCA
AATCGCAGATCAATGATCTGGCCGACGCACAGGATCATCTCGCCTCGGGCAAGATCGCCATGGGCGAGCA
TCACTTCTCGCTGACGGTCTATGCGGACACGATCGAGGAGCTGGATCGGCTGTCCGGCTTAACCCGCACG
GTCATTGCCAATAGTGGCGGCGTCGTCGCGCAAGAGAGTGCGGGGCTGGAAGCCGCCTATTTCGCACAAC
TGCCGGGCAACAGAAAATGGCGCACCAGGCCGGGCACCATCACCACGCGCAATTTCGCGGCCTTCTCCGG
CTTCGAGGCTTTTCCGCGCGGCCAGCGTGCCGGCAAGTGGGGGCCAGCCATGGCGCGCTTCCGCACCACG
GCGGGCACGGCCTATGATTACGTGCCCCATGTCGAGGATGTCGGCATGACGGCGATCTTCGGAAAGATCG
GCCAGGGCAAAACCACGTTCATGCTGTTCCTGCTGGCGCTGTTCCCGCAATATTTCGCGGCCCGCAACGG
TGCCGTGGTGTTCTTCGATAAGGACCGGGGCGGCGAGCTGCTGTGCCGCGCTGTCGGCGGCCGTTATCTG
GTGGTGAGGGCAGGGCGCGATAGCGGCCTGGCGCCCCTCAAGGCGCTCGACAACACCCCGGAATCGGTCG
CCTTCCTCGTTCAGTGGCTAACCGCCCTGATCCAGCAAGACGGGCACGGCCCACTCCCGCCCGAGGATGA
CGCCCGCCTGACCCGAGGCGTTCAAGCCCTGCTGCGCCTGGCCCCGGAAATGCGCTCGCTCGCCGGGCTG
CGTCAGTTCCTCGACTGGCGCAATCCGATGGGGGCAGGCGCACGCCTCGAACGCTGGTGCAAGGGCGGGT
CGCTCGGCTGGGCCTTCGATGGCGAACATGATGACGTGTCGCTTGATGCAACCACGGTCGGCTTTGACCT
GACGGCTATCCTCGACAATGGGACCGTCTGCGCCCCGGCCGCGAATTACCTGCTCTATCGCATCAGCCAG
GCCCTCGATGGCCGCCGCTTTGTCCTGAGTTGCGATGAGTTCAATTTCTATCTGCTCAATCCGCTATTCG
CCAAAATCTGGGCGGATTTCATGCTCACCGTCCGCAAGAGCAACGCCGTTGTGCTGCTGGCGACGCAAGA
GCCCGCGCCGGTGCTCGATTCACCGCAGGGCGATAGCATCTTGCGCCAGTGCCAAACACTCGTGTTCTGC
CCGACGCCTGGCGCCGAGGAAAACCTCTACCGCAAGCGCCTCAACTTCACGGCCGGGGAGTTCCGCGCCA
TCGCCGAGGACATGCTCCCCAACTCCCGGCAACTGCTCATCAAGCGGCATGGCGGCTCCGCGATCATAGA
TTTCGACCTTTCCGCTCTGCCTGAGTTCGTCGCGATCCTGTCGAGCCGCAAATCCTCGGTTGGGTTTGTG
GAACGGCTGCGCGCCACCCATGGCGACGATCCGACGGCCTGGCTGCCGGAGTTCATGGCCCGGTTCCGCG
AGGAAGTTGAATAG
 Primer design