SecReT4
Protein ID: 325168996
T4SS name [ID]VirB [21]
Gene symbolvirB3
Locus tagACMV_P2_00650
StrainAcidiphilium multivorum AIU301
Repliconplasmid pACMV2 [GenBank: NC_015187] [Browse all T4SS(s) in this replicon]
Location [Strand]62758..63090 [-]
Producttype IV secretion system VirB3
Component typeVirB3
UniProt IDF0J7S8
KEGG IDamv:ACMV_P2_00650
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 5.3e-18, Aligned region: 1..82
Protein Sequence: 110 a.a.     [Download]
>gi|325168996|ref|YP_004285743.1| type IV secretion system VirB3 [Acidiphilium multivorum AIU301]
MSERQRDPLFVAATRPALFLGLPIEMAVAIIMIGAMIVIFGHNPFYLTLVLPLWFGARWLVRYDYNAPRV
AWLWFRTKATGAGENQAWGGASPAPFPMKVQKGRGMRDAG
 
Nucleotide Sequence: 333 bp     [Download]
>gi|325168931|ref|NC_015187.1|:c63090-62758 Acidiphilium multivorum AIU301 plasmid pACMV2, complete sequence
ATGAGCGAAAGGCAGCGCGATCCTCTATTTGTCGCCGCGACACGGCCGGCGCTGTTTCTCGGGCTGCCGA
TCGAGATGGCCGTGGCAATCATCATGATCGGCGCGATGATCGTCATCTTTGGGCACAACCCCTTTTATCT
GACGCTGGTGCTGCCGCTCTGGTTCGGGGCGCGCTGGCTCGTTCGCTACGACTACAACGCGCCCCGTGTG
GCCTGGCTGTGGTTCCGCACCAAGGCCACCGGCGCCGGGGAAAATCAGGCTTGGGGCGGGGCATCTCCCG
CGCCGTTCCCGATGAAGGTCCAGAAGGGCAGGGGGATGCGCGATGCCGGGTAA
 Primer design