SecReT4
Protein ID: 325168997
T4SS name [ID]VirB [21]
Gene symbolvirB2
Locus tagACMV_P2_00660
StrainAcidiphilium multivorum AIU301
Repliconplasmid pACMV2 [GenBank: NC_015187] [Browse all T4SS(s) in this replicon]
Location [Strand]63094..63459 [-]
Producttype IV secretion system VirB2
Component typeVirB2
UniProt IDF0J7S9
KEGG IDamv:ACMV_P2_00660
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.4e-19, Aligned region: 27..117
Protein Sequence: 121 a.a.     [Download]
>gi|325168997|ref|YP_004285744.1| type IV secretion system VirB2 [Acidiphilium multivorum AIU301]
MKQRLTKLRAGVANIAAGTASKMGRGSWLQPAVIVAASLLLPAVAHAQVVSGGTSPTTIIDNIATFILGP
FGEGVAVLAVAAVGFMCWTGRVGFHAIGWLAAGLVLVFGSSYLVTTFVGGG
 
Nucleotide Sequence: 366 bp     [Download]
>gi|325168931|ref|NC_015187.1|:c63459-63094 Acidiphilium multivorum AIU301 plasmid pACMV2, complete sequence
GTGAAACAAAGGCTCACTAAGCTACGCGCTGGCGTGGCAAATATCGCGGCTGGGACGGCTAGCAAGATGG
GCCGGGGCTCATGGTTACAGCCTGCCGTTATTGTGGCGGCCAGTCTCCTTCTTCCCGCCGTCGCACATGC
CCAGGTGGTTTCTGGCGGCACCAGCCCCACAACCATCATCGACAACATCGCGACATTCATCCTCGGCCCG
TTCGGCGAGGGCGTTGCCGTGCTCGCCGTGGCCGCAGTCGGCTTCATGTGCTGGACCGGCCGCGTGGGCT
TCCACGCGATCGGCTGGCTCGCGGCCGGCCTGGTTCTGGTGTTCGGCAGCTCCTACCTCGTGACAACCTT
CGTGGGCGGTGGCTGA
 Primer design