SecReT4
Protein ID: 325168998
T4SS name [ID]VirB [21]
Gene symbolvirB1
Locus tagACMV_P2_00670
StrainAcidiphilium multivorum AIU301
Repliconplasmid pACMV2 [GenBank: NC_015187] [Browse all T4SS(s) in this replicon]
Location [Strand]63440..64144 [-]
Producttype IV secretion system VirB1
Component typeVirB1
UniProt IDF0J7T0
KEGG IDamv:ACMV_P2_00670
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 1.4e-24, Aligned region: 10..149
Protein Sequence: 234 a.a.     [Download]
>gi|325168998|ref|YP_004285745.1| type IV secretion system VirB1 [Acidiphilium multivorum AIU301]
MLIAPAIFLALANRCAPEVAPGTLAAVASTESGFNILAIHDNTTRQSIRPLDAPGAIALAKRLIAAGHSV
DLGLMQIDSANLTHLGLTVSTAFDACASVRAGGKLLAQDYKQPNGQGRQAALLAALSRYNTGSAWQGFQN
GYVNRVVSTARYVVPEIDSADSVQAPKASASRQASPSSASSPPRSPSWDVFPNSIGPAGFAAAHAVTLQA
SRASGPSGPAQPSKQETHGETKAH
 
Nucleotide Sequence: 705 bp     [Download]
>gi|325168931|ref|NC_015187.1|:c64144-63440 Acidiphilium multivorum AIU301 plasmid pACMV2, complete sequence
ATGCTGATCGCCCCGGCCATTTTCCTCGCTCTCGCGAATCGCTGCGCCCCCGAGGTCGCACCGGGAACGC
TGGCGGCGGTTGCCAGCACCGAGTCGGGGTTCAACATTTTGGCGATTCACGACAACACCACACGCCAGAG
CATACGGCCCTTGGATGCGCCCGGCGCGATTGCCCTTGCCAAGCGGCTGATTGCCGCCGGGCATTCGGTT
GATCTCGGCCTCATGCAGATCGATAGCGCGAACCTCACCCACTTGGGGCTGACAGTCAGCACGGCCTTTG
ATGCCTGTGCGTCGGTGCGGGCGGGCGGCAAGCTGCTGGCGCAGGATTACAAGCAGCCGAACGGGCAGGG
GCGTCAGGCGGCGCTCCTGGCCGCGCTCTCGCGCTACAACACGGGTTCAGCCTGGCAGGGATTCCAGAAC
GGCTACGTCAACCGCGTGGTCTCAACCGCCAGATATGTTGTGCCTGAAATCGACTCCGCCGATAGCGTGC
AAGCCCCCAAGGCCAGCGCCTCCCGTCAGGCCAGCCCGTCATCCGCCTCATCTCCTCCGCGCTCGCCATC
CTGGGATGTGTTCCCGAACTCGATCGGCCCGGCTGGCTTCGCGGCGGCGCATGCGGTGACGCTTCAAGCG
TCCCGCGCTTCTGGCCCCAGCGGCCCGGCTCAACCCTCAAAACAGGAAACTCACGGTGAAACAAAGGCTC
ACTAA
 Primer design