SecReT4
Protein ID: 325979417
T4SS name [ID]Ydd [629]
Gene symbol-
Locus tagSGGBAA2069_c22170
StrainStreptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Repliconchromosome [GenBank: NC_015215] [Browse all T4SS(s) in this replicon]
Location [Strand]2272762..2275263 [-]
Productconjugative transposon protein
Component typeYddE
UniProt IDF0VUE1
KEGG IDsgg:SGGBAA2069_c22170
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 4.6e-26, Aligned region: 464..762
DUF87 [PF01935], Evalue: 3.4e-06, Aligned region: 465..594
FtsK_SpoIIIE [PF01580], Evalue: 4e-05, Aligned region: 460..510
Protein Sequence: 833 a.a.     [Download]
>gi|325979417|ref|YP_004289133.1| conjugative transposon protein [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069]
MVKRLEYPIAKTDGNMALRKDGVVTAFYRVPNTPITITDTDKKKKHKITVSQVVKKLAKYKYFEVSLIPR
DYLLEEKMRDFSEDLADDSKVLGEQTLNRTVGLLTKEMEIPYEYEWIVGINIEKTIVKNNLTEAVTNQLS
EIAENIAGFLGFEVETLENWYEDYQEIESIIYRLLSPLKAKRLTNEELFYYQRYQFLTYIPHLREDVIAN
RALENVTDTVITVVEEGILKLSSIYGTSYLSILPIGRYSTIFNGFHLGELLQRLSFPVWLKMKAEFIDKS
GLNGQMGRSNNRYRNIMNEAASTDTVQQDDILMGAYSLKDLMKKVGNKEELIRFGAYVTVAASNIKQLKQ
RRQSLLSYFQDMSVSLHEAGHDTPYLFQSLLYGQDLQVTTRKWNHLVTCKGFAELMLFTNTRSGNRIGWY
IGRVDNRLTAWDNIDEAVQGSKNLVLFNATVANKEDIAGKVTKNPHLIITGATGNGKSYLAQLLFLLTSQ
QNVRILYIDPKRELREHYQKVISQPDFARRFPERKKQIENINFVTLDATLESNHGVLDPIVILEKENAQA
TAKNMLLYLLRQATQVELTQTTSLTNAITTVLERREAGETVGFNHVIELLCQDEDKKVVEVGEYFKAIIR
NSILELAFSDGNVKGLSYDERVTVLEIADLSLPKDGVEDISDHEANSICLMFALGAFCKHFGERNDDETL
EIFDEAWILMQSSEGKAVIKSMRRVGRSKYNTLCLVTQSVHDAENEEDSTGFGTIFAFYEKSERKDILKH
VGLEVTEKNLEWLDNMISGQCLYYDVYGNLNMISVHNLFEDIDPFLKPMKQTTSSVLENKYAS
 
Nucleotide Sequence: 2502 bp     [Download]
>gi|325977200|ref|NC_015215.1|:c2275263-2272762 Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069, complete genome
ATGGTAAAGCGTTTGGAATATCCGATAGCAAAGACTGATGGAAATATGGCTTTACGTAAGGACGGTGTTG
TCACGGCTTTTTATCGAGTTCCGAACACACCAATTACAATTACAGATACGGATAAAAAGAAAAAACATAA
GATAACAGTTTCACAAGTGGTTAAGAAGCTAGCAAAATATAAGTATTTTGAAGTTTCTTTGATTCCTAGA
GACTATCTATTAGAAGAAAAAATGCGAGATTTTTCAGAGGATTTAGCTGATGATTCAAAAGTATTAGGTG
AACAAACACTTAATAGAACTGTTGGACTATTGACTAAAGAGATGGAAATTCCTTACGAGTATGAATGGAT
AGTCGGTATTAATATTGAAAAAACGATAGTAAAAAATAATTTAACTGAAGCTGTTACGAATCAATTATCA
GAAATAGCGGAAAATATTGCTGGCTTTTTAGGTTTTGAAGTTGAGACCTTAGAGAATTGGTATGAAGATT
ATCAAGAGATTGAATCCATTATCTATCGCCTACTATCACCGTTAAAAGCAAAACGATTAACAAATGAAGA
ATTGTTCTATTATCAACGGTATCAGTTCTTAACTTATATTCCTCATTTGAGGGAAGATGTGATTGCCAAT
CGTGCTTTGGAAAATGTGACAGATACTGTGATTACCGTTGTTGAAGAGGGAATTTTAAAACTATCTAGTA
TTTACGGTACTTCTTACCTTTCTATTTTGCCAATTGGTCGGTATTCAACGATTTTTAATGGTTTTCATTT
AGGTGAGTTGCTTCAACGATTAAGTTTTCCTGTTTGGTTGAAAATGAAAGCAGAGTTTATTGATAAGTCT
GGTTTAAACGGTCAAATGGGGCGGTCGAATAATCGTTATCGTAACATTATGAATGAAGCGGCTAGTACGG
ATACGGTACAGCAAGATGATATTTTAATGGGTGCTTATTCGTTGAAAGATTTAATGAAAAAAGTTGGTAA
CAAGGAAGAATTGATACGTTTTGGAGCGTATGTGACGGTGGCTGCTTCAAACATTAAACAGTTGAAACAA
CGTCGTCAATCGTTACTTTCTTACTTCCAAGATATGAGTGTTAGTTTGCATGAGGCAGGTCATGATACGC
CTTATCTTTTCCAAAGTTTGCTTTACGGTCAAGATTTGCAAGTTACTACTCGCAAATGGAATCATTTAGT
TACTTGTAAAGGCTTTGCGGAGTTAATGTTGTTTACAAATACACGTTCAGGTAACCGTATTGGTTGGTAT
ATTGGACGAGTAGATAATCGGCTGACTGCTTGGGATAATATTGATGAAGCGGTTCAAGGTTCTAAGAACT
TAGTTCTCTTTAATGCGACCGTCGCAAATAAAGAGGATATTGCTGGTAAAGTAACGAAAAACCCACACTT
GATTATCACAGGTGCAACAGGTAATGGGAAGTCCTATCTTGCCCAATTACTTTTCTTGTTGACAAGCCAA
CAAAATGTGAGAATTTTGTACATTGACCCAAAACGTGAACTCCGTGAGCACTATCAAAAGGTGATTAGTC
AACCTGATTTTGCAAGACGTTTCCCAGAACGTAAAAAACAAATTGAGAATATCAATTTTGTGACCCTTGA
CGCTACTCTTGAATCGAATCATGGGGTACTTGACCCAATTGTGATTTTGGAAAAAGAAAATGCGCAAGCA
ACAGCTAAAAATATGTTGCTTTACTTGTTACGTCAAGCGACACAGGTTGAACTCACTCAAACAACGTCGT
TGACAAATGCGATTACAACGGTTTTAGAACGACGTGAAGCTGGTGAAACAGTTGGTTTTAATCATGTGAT
TGAGCTACTTTGTCAAGACGAGGATAAAAAGGTTGTTGAAGTAGGTGAGTATTTTAAAGCCATTATTCGT
AATTCAATCTTAGAGTTAGCCTTTTCGGACGGCAATGTTAAAGGGCTTTCTTATGATGAACGGGTAACTG
TTTTAGAGATTGCGGATTTGTCATTGCCAAAAGATGGTGTGGAAGATATTTCAGACCATGAAGCAAATTC
AATTTGCTTGATGTTTGCGCTAGGTGCATTTTGTAAACATTTTGGTGAACGTAATGATGATGAAACACTT
GAAATCTTTGATGAAGCATGGATTTTAATGCAATCGTCAGAGGGAAAAGCGGTTATCAAGTCTATGCGTC
GTGTTGGACGGTCTAAATATAACACGCTTTGCTTGGTTACTCAATCTGTTCATGACGCTGAAAACGAAGA
AGATTCTACTGGTTTTGGAACAATCTTTGCCTTTTACGAAAAATCGGAACGAAAAGATATTCTGAAACAT
GTAGGCTTAGAAGTGACTGAAAAAAATCTAGAATGGCTGGATAATATGATTTCAGGACAATGTCTTTATT
ATGATGTTTATGGCAATTTGAACATGATTTCAGTCCATAATCTCTTTGAAGATATTGACCCATTCTTAAA
ACCAATGAAACAAACAACGTCAAGTGTACTAGAAAATAAATACGCTAGCTAG
 Primer design