SecReT4
Protein ID: 325979418
T4SS name [ID]Ydd [629]
Gene symbol-
Locus tagSGGBAA2069_c22180
StrainStreptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Repliconchromosome [GenBank: NC_015215] [Browse all T4SS(s) in this replicon]
Location [Strand]2275335..2275745 [-]
Producthypothetical protein
Component typeYddD
UniProt IDF0VUE2
KEGG IDsgg:SGGBAA2069_c22180
PDB IDNA
Domain hit(s) vs Pfam TcpE [PF12648], Evalue: 2.5e-25, Aligned region: 8..119
Protein Sequence: 136 a.a.     [Download]
>gi|325979418|ref|YP_004289134.1| hypothetical protein SGGBAA2069_c22180 [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069]
MEEEQLFDYGRGINAPYWIQEIKSPKGKRIWYFSTPMQVSFFVVFFLVLIVMFQLLSPLLSWLASHTHSI
SSLLYAILPYKIAKIYTETEPEGKKMHVFIADWLKYWFEFKLDKRAIYQGERVDMEKEFVFEKTHL
 
Nucleotide Sequence: 411 bp     [Download]
>gi|325977200|ref|NC_015215.1|:c2275745-2275335 Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069, complete genome
ATGGAAGAAGAACAATTGTTTGATTACGGTAGGGGTATTAATGCTCCCTACTGGATACAGGAAATTAAGT
CACCTAAAGGAAAGCGTATTTGGTATTTTTCAACGCCAATGCAAGTATCCTTTTTTGTTGTCTTTTTCTT
AGTTTTGATTGTGATGTTTCAACTCTTATCGCCGTTACTGTCGTGGTTAGCGTCGCATACGCATTCGATT
TCTAGTTTGCTTTATGCTATCTTACCGTATAAAATCGCAAAAATTTATACGGAAACAGAACCAGAGGGTA
AAAAAATGCATGTTTTCATTGCTGACTGGTTGAAATATTGGTTTGAGTTTAAGTTAGATAAGCGAGCTAT
TTATCAAGGTGAGCGAGTTGATATGGAAAAAGAGTTTGTTTTTGAGAAAACTCATTTGTAA
 Primer design