SecReT4
Protein ID: 325979428
T4SS name [ID]Ydd [629]
Gene symbol-
Locus tagSGGBAA2069_c22280
StrainStreptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Repliconchromosome [GenBank: NC_015215] [Browse all T4SS(s) in this replicon]
Location [Strand]2280855..2282564 [-]
ProductFtsK/SpoIIIE family protein
Component typeYdcQ
UniProt IDF0VUF2
KEGG IDsgg:SGGBAA2069_c22280
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 8.7e-21, Aligned region: 188..357
DUF853 [PF05872], Evalue: 2.7e-05, Aligned region: 209..268
Protein Sequence: 569 a.a.     [Download]
>gi|325979428|ref|YP_004289144.1| FtsK/SpoIIIE family protein [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069]
MRLLPEYRGRRIRPYMRKLNVTLAFVFSFVLLLPAFAFSYVNIDALKAVDVKTIVILAVLSVLAIVLGIW
FSWFFREQTPFGKKVDRLGILSKYFFEHGFYYEKKRSGQNAKSKIRYPKIYVKQRKYDLDISFEMAGNKF
QDKFSKMGGELEKTLFMDFMETVDDVKYKTYTMAYQAFLNRINVTDVMYEKGKGLLLMKNFYWDFDSDPH
LLVAGGTGGGKTVLLQTLVLALAKIGVVDICDPKQADFVAIADMPAFKGRVAFDVEDIIQRFEKAEVIMM
ARYKFMNDERVRLKHKSLKKYYEYGLEPYFISCDELNALMAMLDYKQRERLDKSLGNILFLGRQAGVFDI
SAMQKPSREDLGSKLQANINMRLNVGRLDDGGYDIMYGEVNRNKDFKYLKYISGRRVYGRGYGAVMGDVA
REFFSPNMPKGFEFYDEFIKLERHENRFDPDENPEISVDIVNDKELLAVATEATNQANQISANKVQTEEI
KYSLKEVADSIGASRPQVFKVVKMIEDDGYTTFEHDDTDKQVLTSSEVALVKELFDFKATNDLTWSNAVE
QYFTKESED
 
Nucleotide Sequence: 1710 bp     [Download]
>gi|325977200|ref|NC_015215.1|:c2282564-2280855 Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069, complete genome
ATGCGATTATTGCCTGAATATAGAGGGCGACGAATTCGTCCGTATATGCGAAAGCTAAATGTGACTTTAG
CTTTCGTTTTTTCTTTTGTGTTGTTGTTACCAGCATTTGCTTTTAGTTATGTTAATATTGACGCTTTAAA
AGCAGTAGATGTTAAAACAATTGTGATTTTAGCTGTTTTAAGTGTTTTGGCAATTGTTTTAGGTATTTGG
TTTTCATGGTTTTTTAGAGAACAAACGCCTTTTGGTAAGAAAGTTGACCGTTTGGGTATTTTATCAAAAT
ATTTTTTTGAACATGGTTTTTATTATGAGAAAAAGCGGTCAGGTCAAAATGCAAAGTCTAAAATTAGGTA
TCCAAAAATTTATGTAAAACAAAGAAAATATGATTTAGATATTTCTTTTGAGATGGCTGGAAACAAGTTT
CAAGATAAGTTTTCAAAAATGGGTGGTGAGCTTGAAAAAACGTTGTTTATGGATTTTATGGAAACAGTAG
ATGATGTTAAATATAAGACTTACACTATGGCTTATCAAGCTTTTCTTAATCGTATTAATGTTACAGATGT
AATGTATGAAAAAGGAAAAGGCTTGTTGCTGATGAAAAATTTTTATTGGGATTTTGATTCAGACCCACAT
TTGCTTGTTGCAGGTGGAACAGGAGGCGGGAAAACGGTCCTTTTGCAAACATTAGTTTTAGCTTTAGCTA
AAATTGGTGTGGTTGATATTTGTGACCCTAAGCAGGCTGATTTTGTAGCGATAGCTGATATGCCAGCTTT
TAAAGGTCGTGTTGCTTTTGATGTTGAAGATATTATACAACGTTTTGAGAAAGCAGAAGTAATCATGATG
GCACGTTATAAATTCATGAATGATGAACGTGTTCGATTGAAACATAAGAGTTTAAAAAAATATTATGAAT
ATGGCTTAGAGCCGTATTTTATTAGTTGTGATGAGCTTAACGCTTTAATGGCAATGTTAGATTATAAACA
ACGTGAACGATTAGATAAATCACTTGGAAACATTTTGTTTTTAGGTCGTCAAGCGGGGGTTTTTGATATT
TCTGCTATGCAAAAACCAAGTCGTGAAGATTTGGGTTCTAAATTGCAAGCAAATATTAATATGCGTTTGA
ATGTTGGGCGTCTTGATGACGGAGGCTATGACATTATGTATGGTGAAGTTAATCGTAACAAAGATTTTAA
ATATCTTAAATATATTTCTGGTCGTCGTGTTTATGGTCGTGGATATGGTGCTGTTATGGGTGATGTGGCT
CGTGAGTTTTTCTCACCGAATATGCCTAAAGGATTTGAGTTTTATGATGAGTTTATTAAATTAGAGCGTC
ATGAAAATCGTTTTGACCCTGATGAAAATCCAGAAATTTCTGTTGATATTGTTAACGATAAAGAACTTTT
GGCGGTTGCCACAGAAGCGACTAATCAGGCTAATCAGATATCGGCTAACAAAGTTCAAACAGAAGAGATT
AAATATAGCTTAAAAGAAGTTGCTGATAGTATTGGTGCTTCTCGTCCACAAGTTTTTAAGGTTGTGAAAA
TGATTGAAGATGACGGTTATACAACTTTTGAGCATGATGATACTGATAAACAGGTATTAACTAGTTCGGA
AGTGGCTTTAGTGAAAGAACTCTTTGATTTTAAAGCAACAAATGATTTAACTTGGTCTAATGCTGTGGAG
CAGTATTTTACCAAAGAAAGTGAAGATTAG
 Primer design