SecReT4
Protein ID: 325980826
T4SS name [ID]Trb [233]
Gene symbol-
Locus tagNAL212_0106
StrainNitrosomonas sp. AL212 plasmid pNAL21202 (NC_015221)
Repliconplasmid pNAL21202 [GenBank: NC_015221] [Browse all T4SS(s) in this replicon]
Location [Strand]6607..7698 [-]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDF0TD60
KEGG IDnit:NAL212_0106
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.6e-29, Aligned region: 68..286
Protein Sequence: 363 a.a.     [Download]
>gi|325980826|ref|YP_004293229.1| P-type conjugative transfer protein TrbL [Nitrosomonas sp. AL212]
MLRISPSTFMIMLFLMCFSASAFAELSYIDPATNQSVLDQVIQKFGGKVKSWQNIIQSAAERLFWTLVII
SMVWTFGMMLLRKADIGDFFAEFTRFIIFTGFYFWLLTNAVSGHNIAGTLIISMEDLGRSAAGLPSGSSH
SSIVDIGILIWKQAMNNLNILDPIDSLIGLIMSLIILIILTVIAVNMLLLLISSWVLMYAGIFLLGFGGA
RWTSDIAINYFKTVLSIGIQLFVMLLIVGIGSDLLSSFYAKMGKNVLNYEELAVMLIFTIAFFVLISRLP
SLLAGIITGSSIGSSAGIGNYSAGGFMAAAGTAAAVASYGGSLAAGRLAAARSAGPDALRSAIEKGQAQE
SAGMNNISQGGGK
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|325980815|ref|NC_015221.1|:c7698-6607 Nitrosomonas sp. AL212 plasmid pNAL21202, complete sequence
ATGCTCAGAATAAGCCCATCCACTTTTATGATTATGTTGTTTCTGATGTGTTTTTCTGCTAGTGCATTTG
CAGAGCTTTCTTATATTGATCCGGCAACTAATCAAAGCGTACTAGATCAGGTTATTCAAAAGTTTGGTGG
CAAAGTAAAGTCCTGGCAGAACATTATCCAATCTGCAGCCGAGCGTTTGTTCTGGACGCTGGTGATCATA
TCGATGGTGTGGACATTTGGCATGATGTTGTTGCGTAAAGCCGATATTGGCGATTTCTTTGCCGAGTTTA
CCCGTTTTATTATCTTCACAGGGTTTTACTTCTGGCTGCTGACCAACGCCGTATCAGGTCACAATATTGC
TGGAACTCTTATTATATCAATGGAGGATTTAGGTAGAAGTGCGGCCGGTTTGCCAAGTGGCTCCAGCCAT
TCCAGCATTGTAGATATTGGCATTTTGATCTGGAAACAAGCCATGAATAATTTGAATATACTGGATCCCA
TAGATAGCTTAATCGGTCTCATTATGTCATTAATTATTCTGATTATATTGACTGTAATTGCAGTCAATAT
GCTGCTCTTGCTAATTTCATCCTGGGTGTTGATGTATGCGGGTATCTTTTTACTTGGCTTTGGCGGAGCG
CGTTGGACATCCGACATCGCCATTAACTACTTTAAAACGGTGCTGAGTATCGGTATTCAGCTATTTGTGA
TGCTCCTGATTGTTGGTATTGGTAGTGACCTGTTATCCAGTTTTTACGCTAAAATGGGTAAAAATGTTCT
GAATTATGAAGAACTGGCGGTTATGCTGATTTTTACAATTGCATTTTTTGTGTTGATTTCCAGATTACCA
TCGTTACTGGCTGGCATTATAACGGGTAGTAGCATAGGCTCGAGCGCCGGAATTGGAAATTATAGCGCCG
GTGGCTTTATGGCAGCGGCTGGTACGGCGGCAGCCGTTGCATCTTATGGTGGATCACTGGCAGCCGGTCG
GCTAGCAGCGGCAAGAAGTGCGGGGCCGGATGCTTTACGCAGCGCTATTGAAAAGGGTCAGGCTCAGGAA
TCTGCGGGTATGAACAATATTTCGCAAGGAGGGGGTAAATAA
 Primer design