SecReT4
Protein ID: 325980831
T4SS name [ID]Trb [233]
Gene symbol-
Locus tagNAL212_0111
StrainNitrosomonas sp. AL212 plasmid pNAL21202 (NC_015221)
Repliconplasmid pNAL21202 [GenBank: NC_015221] [Browse all T4SS(s) in this replicon]
Location [Strand]10672..11598 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDF0TD65
KEGG IDnit:NAL212_0111
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.4e-58, Aligned region: 80..306
Protein Sequence: 308 a.a.     [Download]
>gi|325980831|ref|YP_004293234.1| P-type conjugative transfer protein TrbG [Nitrosomonas sp. AL212]
MKPLLFLSTPSILGTLSMLILSIGLVAPVYANGLSDAYFSDKNPQLTPQERAAIDLAKKWQAVNPSGTKP
VAGPDGSIRFLFGSQQPSIVCAVLQVCDIELQPGEQVNSIHLGDQARWLVEPAVTGQGTLEVQHLIVKPL
DVGLETSLVITTNRRTYHMRLRSHRRDFMPRVGFTYPEDAIAKWDAIKTRESHAMDIRKANTIAQTGEYL
GNLDFAYSVAGDAAWKPLRVYNDGQKTIIQMPAIMAQTEAPTLLLLTKEGGFFSEDETVMVNYRLQGDRY
IVDAVFDKAILVAGVGGNQSRVTITRGN
 
Nucleotide Sequence: 927 bp     [Download]
>gi|325980815|ref|NC_015221.1|:c11598-10672 Nitrosomonas sp. AL212 plasmid pNAL21202, complete sequence
ATGAAACCGTTACTCTTTTTAAGTACCCCAAGTATCCTGGGCACGCTGAGCATGTTGATTTTGTCCATTG
GATTGGTTGCTCCAGTCTATGCCAATGGCTTGTCGGATGCGTATTTCTCCGATAAGAACCCTCAACTGAC
GCCACAGGAACGTGCCGCTATTGATCTGGCCAAGAAATGGCAGGCAGTCAATCCCAGTGGGACAAAGCCG
GTTGCGGGACCGGATGGATCAATCCGTTTTCTGTTCGGTTCACAGCAACCCAGCATCGTCTGTGCAGTAT
TGCAGGTATGCGATATTGAATTGCAGCCGGGGGAGCAGGTGAATTCTATCCACCTGGGCGATCAGGCGCG
CTGGCTGGTTGAACCGGCCGTGACAGGGCAGGGGACTCTTGAGGTACAACATTTAATTGTAAAACCCCTG
GATGTGGGTCTGGAGACATCGCTTGTGATTACGACTAACCGGCGCACGTATCACATGCGATTGCGATCTC
ACCGGCGCGATTTCATGCCGAGAGTGGGGTTTACTTATCCTGAGGATGCGATTGCCAAATGGGATGCCAT
CAAGACCCGGGAAAGTCATGCGATGGACATCAGAAAGGCCAATACGATAGCGCAAACCGGAGAATATCTG
GGCAACCTGGACTTTGCCTACTCTGTTGCCGGAGATGCCGCGTGGAAGCCGCTGCGTGTCTATAACGACG
GTCAAAAAACCATCATACAAATGCCTGCCATCATGGCGCAGACAGAGGCACCGACTCTGTTACTTTTAAC
AAAGGAAGGTGGATTTTTTAGTGAAGATGAAACGGTTATGGTGAATTACCGCTTACAGGGTGATCGGTAT
ATCGTAGATGCGGTATTTGACAAGGCAATTCTTGTTGCTGGAGTGGGCGGCAATCAGAGCCGGGTGACGA
TTACGCGGGGGAATTGA
 Primer design